Sermorelin lab tests

229 certificates of analysis for Sermorelin are on file — 227 for single vials and 2 for blends and other forms — from 133 shops and 17 labs. The latest was tested on 28 Sep 2026.

These are certificates shops have chosen to publish, verified for authenticity before listing. Because shops decide which COAs to make public, the set reflects the batches they published rather than every production batch — a selection bias we state openly. What shop COAs show →

Tests on file

229

227 single vials · 2 blends & other forms

Median purity

99.39%

usual 99.05–99.82% · shop COAs

Measured vs label

110%

median · 6 under 90% · 40 over 120%

Latest test

28 Sep 2026

17 labs · 133 shops

Look up your vial's lot →Sermorelin prices →Sermorelin calculator Get a vial tested

What Sermorelin results look like

single vials only · 226 purity results · 222 measured-content results

Purity is tightly bunched: the middle 80% of results sit within 0.8 points. Measured content spreads across 30 points of the label.

HPLC purity

99.05–99.82%middle 80% of results

median 99.39%91% at 99% or higher2 under 98%

% HPLC purity

Measured content vs label

98–128%middle 80% of results

median 110%6 under 90%40 over 120%

% of the labelled amount

outside the usual rangeEndotoxin reported on 41 of 227 (18%)Confirmed on the lab's own portal: 46 (20%)Most tested size: 10 mg (125), then 5 mg (94)

Latest Sermorelin tests

10 most recent · all formsAll 229 ↓

Latest Sermorelin lab tests
Tested	Shop	Lab	Purity	Measured vs label	Endotoxin	Record
28 Sep 2026	Peptide Hackers	Accumark Labs	99.81%	11.23 / 10 mg 112% of label	—	AM20260925-22✓
21 Sep 2026	Rogue Compounds	ILS Laboratories	99.68%	5.2 / 5 mg 104% of label	—	SER-260808-001✓
21 Sep 2026	ANKR Lab	freedomdiagnosticstesting.com	99.32%	6.33 / 5 mg 127% of label	Pass	1010✓
11 Sep 2026	Backroad Aminos	freedomdiagnosticstesting.com	99.54%	11.4 / 10 mg 114% of label	Pass	0926SMO10✓
3 Aug 2026	BioEdge Research Labs	Kovera Labs	99.49%	5.99 / 5 mg 120% of label	Pass	052626SER5✓
26 Jul 2026	Elevated Peptides	MZ Biolabs	99.45%	not reported	—	2026-07-08
19 Jul 2026	Peptide Foundry	ILS Laboratories	99.28%	10.61 / 10 mg 106% of label	Pass	FO339✓
17 Jul 2026	PepGenics Research	freedomdiagnosticstesting.com	99.34%	5.86 / 5 mg 117% of label	—	SM05060626Q✓
15 Jul 2026	Umbrella Labs	freedomdiagnosticstesting.com	98.17%	2.14 / 2 mg 107% of label	—	ULP-20304A✓
14 Jul 2026	GenPeptide	Kovera Labs	99.63%	6.26 / 5 mg 125% of label	—	GPSER5070726✓

98% or higher95–98%90–95%under 90%✓ found on the lab's own portalHover an endotoxin chip for the lab's exact wording

Results by lab

single vials · labs with the most Sermorelin tests

Sermorelin single-vial results by testing lab
Lab	Tests	Median purity	Median measured vs label	Endotoxin reported	Confirmed on lab portal
freedomdiagnosticstesting.com	72	99.30%	117%	15	19
Janoshik Labs	64	99.35%	107%	0	11
Vanguard Laboratory	19	99.70%	102%	6	1
Kovera Labs	10	99.56%	113%	7	8
BioRegen	9	99.68%	97%	0	0
Chromate	9	99.44%	112%	2	0
Bioviridian	8	99.80%	107%	4	1
MZ Biolabs	7	99.11%	100%	0	0

Differences reflect the vials each lab received and how it reports — this is not a ranking of labs. Every lab with a Sermorelin test on file is linked under More on Sermorelin.

What sermorelin testing has to rule out: Mod GRF (1-29), 10 daltons away

Sermorelin is the unmodified first 29 amino acids of human growth hormone-releasing hormone, amidated: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂, CAS 86168-78-7 (PubChem CID 16132413), C₁₄₉H₂₄₆N₄₄O₄₂S, molecular weight 3,357.9 g/mol. Its nearest market rival, Mod GRF (1-29), sits just 10 Da away at 3,367.9 — a gap no HPLC purity figure addresses and a rounded nominal mass will not settle.

The Met27→Leu27 substitution that produces that gap also removes sermorelin's only sulfur atom, so the two differ in elemental composition as well as mass: C₁₄₉H₂₄₆N₄₄O₄₂S against C₁₅₂H₂₅₂N₄₄O₄₂. Sulfur present or sulfur absent is a binary a composition report can answer, and a composition matching the second formula is not sermorelin regardless of what the label says. CJC-1295 with DAC (C₁₆₅H₂₆₉N₄₇O₄₆, 3,647.2) is the easy case: it sits far enough clear of sermorelin that no instrument confuses the two.

High-resolution mass spectrometry at 3,357.9 Da — not 3,367.9, which is Mod GRF (1-29), and not 3,647.2, which is CJC-1295 with DAC. A nominal mass reported without a decimal place is insufficient for a 10-dalton discrimination.
Elemental composition showing sulfur present: the Met27 residue that Mod GRF (1-29) lacks.
Database naming: querying "CJC-1295" in chemical databases returns the DAC form at 3,647.2, so a product sold as "CJC-1295" at 3,367.9 is Mod GRF (1-29) under a name that belongs to a different molecule — and it looks identical to sermorelin on every document except the identity result.
Fill accuracy, in both directions: one vendor's sermorelin measured 12.88 mg against a 10 mg label, a 28.8% overage (recorded on the sermorelin compound page, verified August 2026). A fill line that runs 28.8% over is not being measured, the same absence of control produces shortfalls, and large overages belong in the red-flag column with shortfalls.
Endotoxin (LAL) data is largely absent across sermorelin listings; most entries report nothing at all.

All Sermorelin tests

229 · newest first · blends tagged

229 records, most recent first.
Tested	Shop	Lab	Purity	Measured vs label	Endotoxin	Record
28 Sep 2026	Peptide Hackers	Accumark Labs	99.81%	11.23 / 10 mg 112% of label	—	AM20260925-22✓
21 Sep 2026	Rogue Compounds	ILS Laboratories	99.68%	5.2 / 5 mg 104% of label	—	SER-260808-001✓
21 Sep 2026	ANKR Lab	freedomdiagnosticstesting.com	99.32%	6.33 / 5 mg 127% of label	Pass	1010✓
11 Sep 2026	Backroad Aminos	freedomdiagnosticstesting.com	99.54%	11.4 / 10 mg 114% of label	Pass	0926SMO10✓
3 Aug 2026	BioEdge Research Labs	Kovera Labs	99.49%	5.99 / 5 mg 120% of label	Pass	052626SER5✓
26 Jul 2026	Elevated Peptides	MZ Biolabs	99.45%	not reported	—	2026-07-08
19 Jul 2026	Peptide Foundry	ILS Laboratories	99.28%	10.61 / 10 mg 106% of label	Pass	FO339✓
17 Jul 2026	PepGenics Research	freedomdiagnosticstesting.com	99.34%	5.86 / 5 mg 117% of label	—	SM05060626Q✓
15 Jul 2026	Umbrella Labs	freedomdiagnosticstesting.com	98.17%	2.14 / 2 mg 107% of label	—	ULP-20304A✓
14 Jul 2026	GenPeptide	Kovera Labs	99.63%	6.26 / 5 mg 125% of label	—	GPSER5070726✓
13 Jul 2026	Glow Aminos	ILS Laboratories	99.25%	5.17 / 5 mg 103% of label	—	GL-010209✓
9 Jul 2026	Blank Peptides	Horizon Analytical	99.35%	4.95 / 5 mg 99% of label	—	B-3441701-P
9 Jul 2026	Ascend Science	Kovera Labs	99.55%	12.64 / 10 mg 126% of label	—	C149H240N44O425✓
29 Jun 2026	Elevated Peptides	MZ Biolabs	98.86%	not reported	—	2026-06-22
25 Jun 2026	Corix Labs	Janoshik Labs	99.55%	10.08 / 10 mg 101% of label	—	SER-10 - 06/26✓
20 Jun 2026	Double R Labs	Kovera Labs	99.56%	11.05 / 10 mg 111% of label	Pass	DRL-06-SMO10✓
19 Jun 2026	Synova Supply	Horizon Analytical	99.31%	4.85 / 5 mg 97% of label	—	SS-9002345-P
16 Jun 2026	Real Peptides	Kovera Labs	99.55%	11.04 / 10 mg 110% of label	Pass	BATCH-0322✓
15 Jun 2026	Oasis Labs	Bioviridian	99.90%	5.28 / 5 mg 106% of label	—	112455✓
14 Jun 2026	Ascension Peptides	Kovera Labs	99.41%	11.03 / 10 mg 110% of label	Pass	38-05260628✓
10 Jun 2026	Glow Aminos	ILS Laboratories	99.86%	10.51 / 10 mg 105% of label	—	GL-010146✓
8 Jun 2026	Adria Science	liquilabs	99.70%	10.5 / 10 mg 105% of label	—	1320227
7 Jun 2026	Peptide Plugs	freedomdiagnosticstesting.com	99.13%	11.1 / 10 mg 111% of label	—	DK-132-09✓
30 May 2026	Backroad Aminos	Kovera Labs	99.44%	11.03 / 10 mg 110% of label	Pass	BA0526SMO10✓
30 May 2026	Kalyx Labs	freedomdiagnosticstesting.com	99.31%	11.12 / 10 mg 111% of label	—	SMO10-B01✓
30 May 2026	Modern Research Peptides	freedomdiagnosticstesting.com	99.49%	12.88 / 10 mg 129% of label	—	CUMK6426✓
30 May 2026	Protide Health	freedomdiagnosticstesting.com	99.21%	6.53 / 5 mg 131% of label	Pass	PH smS 0327
28 May 2026	Studz Peptides	Kovera Labs	99.61%	10.59 / 10 mg 106% of label	Pass	SERM10-051926-LIS✓
27 May 2026	Good Science	Vanguard Laboratory	99.09%	10.19 / 10 mg 102% of label	—	3548339
15 May 2026	EZ Peptides	Janoshik Labs	99.07%	5.43 / 5 mg 109% of label	—	EZP-SER0505052026-05✓
15 May 2026	Ameano Peptides	Janoshik Labs	99.04%	5.44 / 5 mg 109% of label	—	SER0505052026-05✓
12 May 2026	True Research Labs	Horizon Analytical	99.31%	4.85 / 5 mg 97% of label	—	TRL-9002345
12 May 2026	Warrior Makers	MZ Biolabs	98.79%	not reported	—	07-SG5
12 May 2026	LA Peptides	Bioviridian	99.90%	10.38 / 10 mg 104% of label	Pass	1218
11 May 2026	Ignite Peptides	Janoshik Labs	99.87%	5.17 / 5 mg 103% of label	—	sermor41601✓
11 May 2026	Research Peptides Europe	liquilabs	99.80%	9.04 / 10 mg 90% of label	Reported	2026-05-01
8 May 2026	Synthesis Peptides	freedomdiagnosticstesting.com	99.35%	11.9 / 10 mg 119% of label	—	View record →
4 May 2026	Panda Peptides	Janoshik Labs	99.21%	10.13 / 10 mg 101% of label	—	PP2602-0377
4 May 2026	Chameleon PeptidesClosed	Janoshik Labs	99.21%	10.13 / 10 mg 101% of label	—	B002
3 May 2026	Real Peptides	freedomdiagnosticstesting.com	99.41%	5.86 / 5 mg 117% of label	—	View record →
30 Apr 2026	Bluum Peptides	freedomdiagnosticstesting.com	99.41%	5.56 / 5 mg 111% of label	—	SER52604-66G
27 Apr 2026	PeptideTech	freedomdiagnosticstesting.com	99.53%	5.08 / 5 mg 102% of label	Pass	SER5-9905✓
27 Apr 2026	Polaris Peptides	BTLabs	99.60%	10.3 / 10 mg 103% of label	—	POL-SER10-4
27 Apr 2026	Nova Peptide Supply	freedomdiagnosticstesting.com	99.28%	5.11 / 5 mg 102% of label	Pass	NV-P-WCT2
25 Apr 2026	Valor Peptides	Accumark Labs	98.90%	12.24 / 10 mg 122% of label	—	ARC-SRI10-001
23 Apr 2026	Precisely Peptides	Vanguard Laboratory	99.80%	5.12 / 5 mg 102% of label	—	PP412-26-001
22 Apr 2026	Bluum Peptides	freedomdiagnosticstesting.com	99.28%	12.67 / 10 mg 127% of label	—	View record →
21 Apr 2026	S1 Research	freedomdiagnosticstesting.com	99.35%	11.16 / 10 mg 112% of label	Pass	SER04172651✓
21 Apr 2026	NG Peptide	ILS Laboratories	99.91%	10.49 / 10 mg 105% of label	—	SM10-04
17 Apr 2026	KOLD Peptides	Accumark Labs	99.08%	5.8 / 5 mg 116% of label	—	1800
13 Apr 2026	LA Peptides	Bioviridian	99.90%	11.13 / 10 mg 111% of label	Pass	BATCH 1018
10 Apr 2026	24Peptides	liquilabs	99.10%	9.39 / 10 mg 94% of label	Pass	GF-SERM10-B241
10 Apr 2026	Elutide	Horizon Analytical	99.15%	5.05 / 5 mg 101% of label	—	E-2823761-P
9 Apr 2026	Nura Peptide	freedomdiagnosticstesting.com	99.05%	5.94 / 5 mg 119% of label	—	SERM5-04926✓
9 Apr 2026	Peppy&Me	Krause Analytical	99.90%	10.2 / 10 mg 102% of label	—	PMSR102603A
7 Apr 2026	Pure Health Peptides	BioRegen	99.59%	5.77 / 5 mg 115% of label	—	TUY-030926
7 Apr 2026	Pure Health Peptides	BioRegen	99.62%	12.48 / 10 mg 125% of label	—	TUY-030926
5 Apr 2026	Rivn Peptides	freedomdiagnosticstesting.com	99.35%	11.65 / 10 mg 117% of label	—	1331
3 Apr 2026	American Peptides	Bioviridian	99.80%	6.36 / 5 mg 127% of label	Pass	SERMO5-0318
3 Apr 2026	24Peptides	liquilabs	99.20%	5.43 / 5 mg 109% of label	Pass	GF-SERMO5-B241
2 Apr 2026	Core Peptides	Vanguard Laboratory	99.05%	5 / 5 mg 100% of label	—	C73513✓
1 Apr 2026	Peptide Partners	Kovera Labs	99.94%	11.45 / 10 mg 115% of label	Pass	SER202601
31 Mar 2026	New Wave Peptides	Janoshik Labs	99.87%	5.17 / 5 mg 103% of label	—	20100/A
29 Mar 2026	Kimera Chems	freedomdiagnosticstesting.com	99.20%	5.76 / 5 mg 115% of label	—	KC-SEM-GRN1
28 Mar 2026	Glacier Aminos	Kovera Labs	99.98%	11.71 / 10 mg 117% of label	—	SERMGA-02
22 Mar 2026	Signum Scientific	Horizon Analytical	99.15%	5.05 / 5 mg 101% of label	—	SRM-05-01
18 Mar 2026	Modified Aminos	Vanguard Laboratory	98.21%	5.6 / 5 mg 112% of label	—	MA-SERM-501
16 Mar 2026	Vandl Labs	Vanguard Laboratory	98.44%	4.71 / 5 mg 94% of label	Pass	SM.04.01.05
15 Mar 2026	Glow Aminos	freedomdiagnosticstesting.com	99.13%	6.36 / 5 mg 127% of label	Pass	GL-010068✓
14 Mar 2026	Luvion Bio Peptides	freedomdiagnosticstesting.com	99.54%	11.78 / 10 mg 118% of label	—	LBL-1025-SMO10-1114
11 Mar 2026	Petratide Science	freedomdiagnosticstesting.com	99.84%	11.9 / 10 mg 119% of label	—	PS03-SMW
10 Mar 2026	Penguin Peptides	Janoshik Labs	94.50%	10.46 / 10 mg 105% of label	—	View record →
6 Mar 2026	GenPeptide	freedomdiagnosticstesting.com	99.74%	6.94 / 5 mg 139% of label	—	GPSER05030526✓
5 Mar 2026	LA Peptides	Bioviridian	99.80%	10.2 / 10 mg 102% of label	Pass	818
5 Mar 2026	NuScience Peptides	freedomdiagnosticstesting.com	99.91%	6.6 / 5 mg 132% of label	—	000256
2 Mar 2026	Aminos Research	Janoshik Labs	99.44%	5.47 / 5 mg 109% of label	—	SERM-0002
2 Mar 2026	Aminos Research	Janoshik Labs	99.71%	11.14 / 10 mg 111% of label	—	SERM-0001
27 Feb 2026	AminoQuest Labs	freedomdiagnosticstesting.com	99.12%	12.75 / 10 mg 127% of label	—	AQ-SMO10-226-M
26 Feb 2026	Trusted Peptides	BioRegen	99.63%	12.4 / 10 mg 124% of label	—	View record →
25 Feb 2026	Nexaph	Janoshik Labs	99.69%	5.61 / 5 mg 112% of label	—	SER0502132026-04
24 Feb 2026	Disguised Alpha	Chromate	99.01%	6.33 / 5 mg 127% of label	—	View record →
20 Feb 2026	Next Gen Compounds	Janoshik Labs	99.06%	5.17 / 5 mg 103% of label	—	SRM-05-001-0123
19 Feb 2026	Pure U.S. Peptides	Vanguard Laboratory	99.27%	9.92 / 10 mg 99% of label	Pass	S26C593
17 Feb 2026	Peptide Maxxing	Janoshik Labs	99.91%	10.62 / 10 mg 106% of label	—	SER483✓
17 Feb 2026	Protide Health	freedomdiagnosticstesting.com	99.57%	13.3 / 10 mg 133% of label	—	View record →
17 Feb 2026	Felix Chemical Supply	freedomdiagnosticstesting.com	99.13%	12.85 / 10 mg 129% of label	—	021326-SER-C
16 Feb 2026	Amino Tech	freedomdiagnosticstesting.com	99.61%	5.86 / 5 mg 117% of label	—	View record →
16 Feb 2026	Amino Tech	freedomdiagnosticstesting.com	99.95%	4.78 / 5 mg 96% of label	—	View record →
16 Feb 2026	Modern Research Peptides	freedomdiagnosticstesting.com	99.23%	5.74 / 5 mg 115% of label	—	LCHK264✓
16 Feb 2026	Midshire Labs (formerly Regen Peptides)	Janoshik Labs	99.34%	5.7 / 5 mg 114% of label	—	SR5-0202
16 Feb 2026	Grey Market Peptide	freedomdiagnosticstesting.com	99.61%	5.86 / 5 mg 117% of label	—	View record →
16 Feb 2026	Prime Peptides	Janoshik Labs	99.80%	10.14 / 10 mg 101% of label	—	01222026SR
16 Feb 2026	Modern Aminos	freedomdiagnosticstesting.com	99.57%	6.53 / 5 mg 131% of label	Pass	BX-P-R1J6
16 Feb 2026	Soma ChemsClosed	freedomdiagnosticstesting.com	99.61%	5.86 / 5 mg 117% of label	—	Soma2602130253
15 Feb 2026	Peptidology	Vanguard Laboratory	99.37%	9.85 / 10 mg 99% of label	—	1668
15 Feb 2026	Peptidology	Vanguard Laboratory	99.80%	10.7 / 10 mg 107% of label	—	1669
12 Feb 2026	AMC Essentials	freedomdiagnosticstesting.com	99.09%	11.09 / 10 mg 111% of label	Pass	SER10-0009ACF✓
12 Feb 2026	Cosmic Peptides	Bioviridian	99.70%	11.05 / 10 mg 111% of label	—	26085
12 Feb 2026	Felix Chemical Supply	freedomdiagnosticstesting.com	98.36%	5.17 / 5 mg 103% of label	—	020526-SER-B
10 Feb 2026	PeptidePro Canada	Janoshik Labs	99.70%	11.14 / 10 mg 111% of label	—	2511-0-261
10 Feb 2026	Valor Peptides	Accumark Labs	98.83%	11.39 / 10 mg 114% of label	—	SE0002
10 Feb 2026	Amino USA	BioRegen	99.42%	14.61 / 15 mg 97% of label	—	26SERM15-0002
9 Feb 2026	Licensed Peptides	Vanguard Laboratory	99.80%	10.16 / 10 mg 102% of label	Pass	SERMORE-01
9 Feb 2026	OROS Research	freedomdiagnosticstesting.com	99.61%	5.9 / 5 mg 118% of label	—	1451922
8 Feb 2026	Molecular Solutions Peptides	freedomdiagnosticstesting.com	99.04%	13.19 / 10 mg 132% of label	—	R260122-SRM10-W001✓
7 Feb 2026	BioEdge Research Labs	MDx BioAnalytical Laboratory	99.74%	5.06 / 5 mg 101% of label	Pass	260128SR53✓
7 Feb 2026	Ascension Peptides	MZ Biolabs	99.79%	11.31 / 10 mg 113% of label	—	38-01260229
7 Feb 2026	Mile High Compounds	Vanguard Laboratory	99.80%	10.58 / 10 mg 106% of label	—	SER-010-MH-03
7 Feb 2026	Mile High Compounds	Vanguard Laboratory	99.80%	10.48 / 10 mg 105% of label	—	SER-010-MH-03
5 Feb 2026	Nova Peptide Supply	freedomdiagnosticstesting.com	99.50%	6.62 / 5 mg 132% of label	Pass	NV-P-6OQCI
5 Feb 2026	Ion Peptide	freedomdiagnosticstesting.com	99.09%	3.89 / 5 mg 78% of labelCheck label	—	SERM5-02022026
5 Feb 2026	Instant Peptides	freedomdiagnosticstesting.com	99.46%	10.59 / 10 mg 106% of label	Pass	2026-0289-C
28 Jan 2026	Umbrella Labs	Vanguard Laboratory	99.70%	4.96 / 5 mg 99% of label	—	ULP-20304
28 Jan 2026	24Peptides	liquilabs	99.30%	10.52 / 10 mg 105% of label	Pass	GF122025095
27 Jan 2026	True Research Labs	Horizon Analytical	99.21%	5.8 / 5 mg 116% of label	—	TRL-9912173
27 Jan 2026	Liberty Peptides	Bioviridian	99.05%	5.45 / 5 mg 109% of label	—	LPUS21002
26 Jan 2026	National Science Labs	freedomdiagnosticstesting.com	99.33%	not reported	—	View record →
24 Jan 2026	Ion Peptide	freedomdiagnosticstesting.com	99.28%	11.68 / 10 mg 117% of label	—	SRM10-01212026
23 Jan 2026	PeakForm Peptides	freedomdiagnosticstesting.com	99.45%	6.61 / 5 mg 132% of label	—	PF-2026-034
21 Jan 2026	Instant Peptides	freedomdiagnosticstesting.com	99.13%	13.45 / 10 mg 135% of label	—	2026-0289-A
16 Jan 2026	Blue Sky Peptide	MZ Biolabs	99.11%	not reported	—	8SW0126
15 Jan 2026	ThreeSide Peptides	Krause Analytical	99.10%	8.58 / 10 mg 86% of label	—	SMO102512
15 Jan 2026	Glacier Aminos	freedomdiagnosticstesting.com	99.14%	13.26 / 10 mg 133% of label	Pass	SERMGA01
14 Jan 2026	GenPeptide	freedomdiagnosticstesting.com	99.15%	11.71 / 10 mg 117% of label	—	SPSER05122825✓
13 Jan 2026	Chameleon PeptidesClosed	Janoshik Labs	99.22%	5.05 / 5 mg 101% of label	—	View record →
13 Jan 2026	Nova Peptide Supply	freedomdiagnosticstesting.com	99.24%	6.76 / 5 mg 135% of label	Pass	NV-P-N3DV
12 Jan 2026	Peptide Hubs	Janoshik Labs	99.30%	5.12 / 5 mg 102% of label	—	GASER12✓
9 Jan 2026	Cosmic Peptides	Bioviridian	99.80%	9.78 / 10 mg 98% of label	—	25050
9 Jan 2026	Synthesis Peptides	freedomdiagnosticstesting.com	99.18%	11.78 / 10 mg 118% of label	—	View record →
3 Jan 2026	Perfect Peptides	Krause Analytical	99.63%	11.3 / 10 mg 113% of label	—	PP4364228
3 Jan 2026	Loti Labs	SR Bio Labs	99.97%	2.74 / 2 mg 137% of label	—	LOT-SERM-00005
31 Dec 2025	Felix Chemical Supply	freedomdiagnosticstesting.com	99.35%	11.48 / 10 mg 115% of label	—	122925-SEM-0
26 Dec 2025	Peptira	freedomdiagnosticstesting.com	99.20%	11.71 / 10 mg 117% of label	Pass	SERM10-005
23 Dec 2025	Felix Chemical Supply	freedomdiagnosticstesting.com	99.73%	11.7 / 10 mg 117% of label	—	121525-SER-C
19 Dec 2025	Peptide Crafters	Janoshik Labs	99.11%	10.09 / 10 mg 101% of label	—	PC-G2-SER10
18 Dec 2025	Certified Peptides	Vanguard Laboratory	99.48%	4.9 / 5 mg 98% of label	Pass	250904SERM5
18 Dec 2025	Growth Guys	Janoshik Labs	99.46%	11.75 / 10 mg 118% of label	—	SER03
18 Dec 2025	Felix Chemical Supply	freedomdiagnosticstesting.com	99.60%	12.58 / 10 mg 126% of label	—	121525-SER-0
18 Dec 2025	Optima Supply	Janoshik Labs	99.57%	9.92 / 10 mg 99% of label	—	OP-SER-M4Z6
12 Dec 2025	Peptide Hackers	Janoshik Labs	99.09%	4.91 / 5 mg 98% of label	—	11-2025
11 Dec 2025	Licensed Peptides	Vanguard Laboratory	98.36%	5.25 / 5 mg 105% of label	Pass	1024S10
11 Dec 2025	Real Peptides	BioRegen	99.75%	4.3 / 5 mg 86% of label	—	View record →
11 Dec 2025	Ion Peptide	freedomdiagnosticstesting.com	98.91%	11.48 / 10 mg 115% of label	—	SM10-12082025
9 Dec 2025	Core PeptidesBlendSermorelin/Ipamorelin	Vanguard Laboratory	99.26%	4.04 / 5 mg 81% of label	—	C73510
2 Dec 2025	Alpha Carbon Labs	Janoshik Labs	99.11%	5.59 / 5 mg 112% of label	—	View record →
2 Dec 2025	Tydes	Janoshik Labs	99.22%	12.9 / 10 mg 129% of label	—	SER10112525
2 Dec 2025	Skye Peptides	Janoshik Labs	99.11%	12.55 / 10 mg 126% of label	—	SR25-10-002
27 Nov 2025	BetterBio Synthesis	freedomdiagnosticstesting.com	99.33%	11.19 / 10 mg 112% of label	—	SERM112020225-J
26 Nov 2025	Peptidology	Vanguard Laboratory	99.12%	9.57 / 10 mg 96% of label	—	1667
23 Nov 2025	Ion Peptide	freedomdiagnosticstesting.com	99.16%	17.21 / 15 mg 115% of label	—	SR15-1125
22 Nov 2025	Riptide Wellness	ILS Laboratories	99.12%	11.31 / 10 mg 113% of label	Pass	RWSER-10-1001
18 Nov 2025	Elite Research USA	freedomdiagnosticstesting.com	98.54%	11.05 / 10 mg 111% of label	—	51AN1125
12 Nov 2025	Peptide Supply Co	freedomdiagnosticstesting.com	99.10%	12.09 / 10 mg 121% of label	—	View record →
12 Nov 2025	Ion Peptide	freedomdiagnosticstesting.com	99.28%	5.94 / 5 mg 119% of label	—	SRM10-1125
10 Nov 2025	Atomik Labz	Janoshik Labs	99.53%	12.55 / 10 mg 126% of label	—	F1024F
9 Nov 2025	Kimera Chems	freedomdiagnosticstesting.com	99.23%	6.79 / 5 mg 136% of label	—	KC-SEM-BLU2
9 Nov 2025	Peptira	freedomdiagnosticstesting.com	99.19%	11.73 / 10 mg 117% of label	Pass	SERM10-004
4 Nov 2025	Molecular Solutions Peptides	Janoshik Labs	99.73%	10.92 / 10 mg 109% of label	—	R251022-SRM10-N001✓
3 Nov 2025	Kimera Chems	freedomdiagnosticstesting.com	99.39%	7.47 / 5 mg 149% of label	—	KC-SEM-BLU1
31 Oct 2025	Peptide Pros	freedomdiagnosticstesting.com	99.06%	13.09 / 10 mg 131% of label	—	SER10-110125
30 Oct 2025	Peptide Crafters	Janoshik Labs	99.29%	10.74 / 10 mg 107% of label	—	PC-G1-SER10
30 Oct 2025	Peptide CraftersBlendSermorelin/Ipamorelin	Vanguard Laboratory	99.50%	10.5 / 10 mg 105% of label	—	View record →
22 Oct 2025	Mile High Compounds	Chromate	99.46%	11.39 / 10 mg 114% of label	Pass	SER-010-MH-02
21 Oct 2025	Eternal Peptides	Janoshik Labs	99.38%	10.54 / 10 mg 105% of label	—	EP-250815-SE10
21 Oct 2025	Instant Peptides	freedomdiagnosticstesting.com	99.33%	12.99 / 10 mg 130% of label	—	2025-0289-A
18 Oct 2025	Amplified Labs	freedomdiagnosticstesting.com	99.27%	10.73 / 10 mg 107% of label	—	SER-B10HCK10B
16 Oct 2025	Pure Health Peptides	BioRegen	99.86%	9.1 / 10 mg 91% of label	—	TUY-101025
16 Oct 2025	Pure Health Peptides	BioRegen	99.89%	4.6 / 5 mg 92% of label	—	TUY-101025
16 Oct 2025	Go Alpha Labs	freedomdiagnosticstesting.com	99.30%	11.49 / 10 mg 115% of label	—	LO07-10
16 Oct 2025	Peptide Crafters	Janoshik Labs	99.16%	5.27 / 5 mg 105% of label	—	PC-G1-SM5
14 Oct 2025	Ion Peptide	freedomdiagnosticstesting.com	99.54%	11.08 / 10 mg 111% of label	—	SR1-1025
7 Oct 2025	Kensington Labs	Janoshik Labs	99.52%	4.93 / 5 mg 99% of label	—	SRM-282UT
6 Oct 2025	Skye Peptides	Janoshik Labs	99.33%	5.93 / 5 mg 119% of label	—	SR25-05-002
3 Oct 2025	Blank Peptides	freedomdiagnosticstesting.com	99.24%	5.46 / 5 mg 109% of label	—	SERM09302025-J
1 Oct 2025	Honest Peptide	Janoshik Labs	99.09%	10.14 / 10 mg 101% of label	—	SMO1009122025✓
1 Oct 2025	Valor Peptides	Vanguard Laboratory	99.80%	10.62 / 10 mg 106% of label	Pass	SE0001
1 Oct 2025	Honest Peptide	Janoshik Labs	99.09%	10.14 / 10 mg 101% of label	—	SM01009122025
28 Sep 2025	Amplified Labs	freedomdiagnosticstesting.com	99.40%	12.08 / 10 mg 121% of label	—	SER-A105R09
26 Sep 2025	Purity Peptides	MDx BioAnalytical Laboratory	99.80%	10.31 / 10 mg 103% of label	—	View record →
25 Sep 2025	Growth Guys	Janoshik Labs	99.74%	11.21 / 10 mg 112% of label	—	SER02
23 Sep 2025	OROS Research	freedomdiagnosticstesting.com	98.46%	5.04 / 5 mg 101% of label	—	416318
13 Sep 2025	Amino Lair	freedomdiagnosticstesting.com	99.45%	9.51 / 10 mg 95% of label	—	2509110011
13 Sep 2025	Power Peptides	Chromate	99.81%	11.22 / 10 mg 112% of label	Reported	010725-HO-SN-10
9 Sep 2025	EZ Peps	Janoshik Labs	99.94%	11.87 / 10 mg 119% of label	—	H21650828✓
9 Sep 2025	Srylab	Janoshik Labs	99.94%	11.96 / 10 mg 120% of label	—	H21650828
8 Sep 2025	Profound Aminos	Janoshik Labs	99.51%	5.13 / 5 mg 103% of label	—	View record →
8 Sep 2025	Profound Aminos	Janoshik Labs	99.66%	7.97 / 10 mg 80% of labelCheck label	—	View record →
5 Sep 2025	HPR	Janoshik Labs	99.34%	5.12 / 5 mg 102% of label	—	SRM0828J
27 Aug 2025	Blank Peptides	freedomdiagnosticstesting.com	98.65%	7.02 / 5 mg 140% of label	—	SER0508212025-03
27 Aug 2025	Peptide Partners	BioRegen	99.84%	8.68 / 10 mg 87% of label	—	SM20250723
20 Aug 2025	EZ Peps	Janoshik Labs	99.45%	5.86 / 5 mg 117% of label	—	SR50807✓
20 Aug 2025	Felix Chemical Supply	Chromate	98.26%	10.71 / 10 mg 107% of label	—	81825-SER-8
15 Aug 2025	Strate Labs	Janoshik Labs	99.73%	10.13 / 10 mg 101% of label	—	View record →
13 Aug 2025	Peptira	Janoshik Labs	99.12%	10.36 / 10 mg 104% of label	—	SERM10-003
13 Aug 2025	Peptira	Janoshik Labs	99.24%	11.74 / 10 mg 117% of label	—	SERM10-002
10 Aug 2025	Peptidology	Vanguard Laboratory	99.80%	10.6 / 10 mg 106% of label	—	01-077-PD-1359
4 Aug 2025	Limitless Biotech	Janoshik Labs	98.86%	5.34 / 5 mg 107% of label	—	1269
4 Aug 2025	Limitless Biotech	Janoshik Labs	98.84%	5.58 / 5 mg 112% of label	—	1269
2 Aug 2025	Eternal Peptides	Janoshik Labs	99.23%	4.46 / 5 mg 89% of label	—	EP-250417-SE05
24 Jul 2025	Polaris Peptides	Chromate	99.42%	10.32 / 10 mg 103% of label	—	POL-SER10-2
22 Jul 2025	Tydes	Janoshik Labs	99.61%	6.49 / 5 mg 130% of label	—	SER5071425
22 Jul 2025	Soma ChemsClosed	Chromate	99.37%	5.53 / 5 mg 111% of label	—	View record →
22 Jul 2025	Skye Peptides	Janoshik Labs	99.74%	6.4 / 5 mg 128% of label	—	SR25-5-001
22 Jul 2025	Skye Peptides	Janoshik Labs	—	10.22 / 10 mg 102% of label	—	SR25-10-001
16 Jul 2025	Peptira	Janoshik Labs	99.17%	10.83 / 10 mg 108% of label	—	SERM10-001
14 Jul 2025	Peptide Crafters	Vanguard Laboratory	99.80%	10.62 / 10 mg 106% of label	—	PC-G-SER10
16 Jun 2025	HkRoids	freedomdiagnosticstesting.com	99.76%	4.93 / 5 mg 99% of label	—	0362
16 Jun 2025	Peptidic	Janoshik Labs	99.92%	5.35 / 5 mg 107% of label	—	042025
12 Jun 2025	Felix Chemical Supply	Chromate	99.48%	11.73 / 10 mg 117% of label	—	060525-SER-1
14 May 2025	Cernum Biosciences	Janoshik Labs	99.13%	7.25 / 5 mg 145% of label	—	View record →
28 Apr 2025	Peptide Pros	MZ Biolabs	99.37%	5 / 5 mg 100% of label	—	2025-04-10 white cap
16 Apr 2025	Atomik Labz	Janoshik Labs	99.64%	9.7 / 10 mg 97% of label	—	0410
11 Apr 2025	Peptidic	Janoshik Labs	99.52%	10.43 / 10 mg 104% of label	—	042025
10 Apr 2025	Peptide Crafters	Janoshik Labs	99.29%	5.78 / 6 mg 96% of label	—	PC-G-SM5
28 Mar 2025	Skye Peptides	Janoshik Labs	99.50%	11.46 / 10 mg 115% of label	—	SER10N031925
13 Mar 2025	Royal Peptides	Janoshik Labs	99.81%	11.46 / 10 mg 115% of label	—	View record →
7 Feb 2025	Peptide Crafters	Janoshik Labs	99.35%	4.81 / 5 mg 96% of label	—	PC-Z1-SM5
31 Jan 2025	Amino USA	BioRegen	99.68%	15 / 15 mg 100% of label	—	25SERM15-0001
15 Jan 2025	Growth Guys	Janoshik Labs	99.12%	5.01 / 5 mg 100% of label	—	SER01
1 Jan 2025	Research Peptides Lab	freedomdiagnosticstesting.com	96.71%	5 / 5 mg 100% of label	—	86168-78-7
23 Dec 2024	Biolabshop	Analiza Białek	98.00%	2.13 / 2 mg 107% of label	—	100006563
21 Nov 2024	Power Peptides	Chromate	99.84%	9.72 / 10 mg 97% of label	—	View record →
18 Nov 2024	Polaris Peptides	Chromate	99.44%	11.61 / 10 mg 116% of label	—	POL-SET10-1
28 Oct 2024	Research Ready Peptides	Vanguard Laboratory	99.86%	9.98 / 10 mg 100% of label	—	ALYSRL-10-1
18 Oct 2024	Skye Peptides	Janoshik Labs	99.67%	5.86 / 5 mg 117% of label	—	SR24-05-002
23 Sep 2024	Atomik Labz	Janoshik Labs	99.18%	11.62 / 10 mg 116% of label	—	FF0910
23 Sep 2024	Skye Peptides	Janoshik Labs	99.34%	10.73 / 10 mg 107% of label	—	SR24-10-001
11 Jul 2024	Skye Peptides	Janoshik Labs	99.65%	6.09 / 5 mg 122% of label	—	SR24-05-001
13 Nov 2023	Amino USA	MZ Biolabs	98.30%	1.88 / 2 mg 94% of label	—	2023-10-23

Measured amount in amber when it is under 90% or over 130% of the label; Check label when it is under 80% or over 150%. Records without a lot number link as View →. Blend and other-form rows keep their place and page; they are tagged and left out of the figures above, because a blend certificate reports one purity and one amount for the whole vial.

Seven checks for any Sermorelin certificate

The same seven questions decide whether a certificate of analysis means anything, whichever compound it describes. Six are about the document; the seventh is about what no document can tell you.

An independent, batch-matched COA. The certificate must name the batch or lot in your hands, and must come from a laboratory the vendor neither owns nor pays. A specimen certificate from an earlier lot proves nothing about the vial you were sent.
HPLC purity, read against a known band. A purity figure is only informative against the distribution for that compound. "Above 98%" is not a claim — the useful question is whether the result sits inside the range the rest of the market reports. How to read HPLC and mass-spec results.
Mass-spectrometry identity. HPLC says how much of the sample is one thing; it does not say which thing. Only a mass-spec result establishes identity, and it is the only check that separates compounds a few daltons apart. Contamination is not hypothetical: research-grade custom peptides from two independent commercial suppliers were found to carry contaminating peptides at roughly 1% by weight, enough to produce false-positive results in immunology assays (Clinical and Vaccine Immunology, 2008 — a study of HIV vaccine peptide libraries rather than of any compound on this site).
Net content, measured rather than assumed. Purity and quantity are different questions: a vial can be 99.7% pure and still contain two thirds of the labelled mass. Why 10 mg isn't 10 mg.
Endotoxin (LAL) on the batch. An absent endotoxin line means the batch was not tested — not that it passed. Endotoxin testing and LAL interpretation.
Who ran the test, and what they left off. A laboratory with a record on this compound, named on the certificate, with a verification route back to it. Testing laboratories we track · Red flags in a certificate of analysis.
What no test on the vial can establish. A perfect certificate confirms that a vendor sold the correct molecule at the stated quantity. It says nothing about efficacy, dosing, or long-term safety.

Want a vial tested yourself? How to send a peptide for independent HPLC testing.