Tesamorelin lab tests

564 certificates of analysis for Tesamorelin are on file — 536 for single vials and 28 for blends and other forms — from 244 shops and 26 labs. The latest was tested on 1 Oct 2026.

These are certificates shops have chosen to publish, verified for authenticity before listing. Because shops decide which COAs to make public, the set reflects the batches they published rather than every production batch — a selection bias we state openly. What shop COAs show →

Tests on file

564

536 single vials · 28 blends & other forms

Median purity

99.49%

usual 99.02–99.88% · shop COAs

Measured vs label

107%

median · 12 under 90% · 78 over 120%

Latest test

1 Oct 2026

26 labs · 244 shops

Look up your vial's lot →Tesamorelin prices →Tesamorelin calculator Get a vial tested

What Tesamorelin results look like

single vials only · 536 purity results · 533 measured-content results

Purity is tightly bunched: the middle 80% of results sit within 0.9 points. Measured content spreads across 26 points of the label.

HPLC purity

99.02–99.88%middle 80% of results

median 99.49%93% at 99% or higher5 under 98%

% HPLC purity

Measured content vs label

98–124%middle 80% of results

median 107%12 under 90%78 over 120%

% of the labelled amount

outside the usual rangeEndotoxin reported on 125 of 536 (23%)Confirmed on the lab's own portal: 148 (28%)Most tested size: 10 mg (385), then 20 mg (64) and 5 mg (60)

Latest Tesamorelin tests

10 most recent · all formsAll 564 ↓

Latest Tesamorelin lab tests
Tested	Shop	Lab	Purity	Measured vs label	Endotoxin	Record
1 Oct 2026	Peptide Hackers	Accumark Labs	99.88%	4.75 / 10 mg 48% of labelCheck label	—	AM20260925-10✓
23 Sep 2026	Veratis Bio Peptides	freedomdiagnosticstesting.com	99.49%	11.36 / 10 mg 114% of label	Pass	TESA0001✓
22 Sep 2026	DNA Peptides	SideChain Analytics	99.60%	10.43 / 10 mg 104% of label	—	DNA-TESA10-2609-01✓
21 Sep 2026	ANKR Lab	freedomdiagnosticstesting.com	99.72%	11.19 / 10 mg 112% of label	Pass	1010✓
19 Sep 2026	NorthStar Compounds	Axiom Analytics	99.87%	10.68 / 10 mg 107% of label	Pass	TS12603✓
8 Sep 2026	Purely Peptides	Bioviridian	99.74%	10.35 / 10 mg 103% of label	—	TSM-20260828-01✓
3 Sep 2026	PSL Labs	Janoshik Labs	97.78%	9.91 / 10 mg 99% of label	—	PSL-TESA-10MG✓
2 Sep 2026	10 Bottle Value	BTLabs	99.80%	12.7 / 10 mg 127% of label	—	9mhy3wt
28 Aug 2026	Vistara Labs	—	99.79%	10.15 / 10 mg 102% of label	Pass	00011/0011
24 Aug 2026	NovaForge Labs	freedomdiagnosticstesting.com	99.03%	20.67 / 20 mg 103% of label	—	NFL-0002✓

98% or higher95–98%90–95%under 90%✓ found on the lab's own portalHover an endotoxin chip for the lab's exact wording

Results by lab

single vials · labs with the most Tesamorelin tests

Tesamorelin single-vial results by testing lab
Lab	Tests	Median purity	Median measured vs label	Endotoxin reported	Confirmed on lab portal
freedomdiagnosticstesting.com	189	99.38%	111%	55	62
Janoshik Labs	104	99.44%	109%	1	19
Kovera Labs	35	99.75%	112%	26	23
Vanguard Laboratory	32	99.37%	102%	9	2
ILS Laboratories	30	99.63%	104%	5	23
Chromate	21	99.21%	105%	5	6
Bioviridian	17	99.80%	105%	6	3
BioRegen	15	99.74%	103%	1	0

Differences reflect the vials each lab received and how it reports — this is not a ranking of labs. Every lab with a Tesamorelin test on file is linked under More on Tesamorelin.

What tesamorelin testing has to rule out: the missing hexenoyl group

Tesamorelin is a 44-amino-acid analogue of human growth hormone-releasing hormone — the full GHRH(1-44), YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL, not a fragment — modified by a trans-3-hexenoyl group on the N-terminal tyrosine and amidated at the C-terminus: CAS 218949-48-5 (PubChem CID 16137828), C₂₂₁H₃₆₆N₇₂O₆₇S, 5,136 Da. Substitution by a neighbour is easy to catch. Tesamorelin sits 1,778 Da above sermorelin (3,357.9) and 1,489 above CJC-1295 with DAC (3,647.2), gaps unmissable on a mass spectrum and invisible on an HPLC purity certificate. A vial sold as tesamorelin that measures around 3,400 Da is sermorelin, and anything reading in the 3,000s is not tesamorelin regardless of the label.

The subtle identity check is the acylation. The hexenoyl group is what protects the molecule from dipeptidyl peptidase-4 (DPP-4) degradation, and it is the only part of this molecule's identity that a careless synthesis can quietly omit while still producing a 44-residue peptide. A mass reading around 5,040 is unmodified GHRH(1-44), not tesamorelin — the hexenoyl group is roughly the whole difference.

Mass spectrometry at 5,136 Da on a batch-matched certificate, with the mass matching the hexenoyl-modified form rather than unmodified GHRH(1-44) at around 5,040.
Database caution: PubChem's CJC-1295 record has had both "CJC1295 With DAC" and "CJC1295 Without DAC" listed as synonyms and subsequently removed them, so treat that record as the DAC form only.
Fill accuracy: one vendor's sample on this platform tested 23.6% above labelled quantity (verified August 2026). A fill process that runs 23.6% over is not being measured and produces shortfalls just as readily; quantitative content testing is the check.
Endotoxin (LAL) results are absent from most tesamorelin entries on this platform.

All Tesamorelin tests

565 records · 1 supplier-provided, listed and left out of the benchmarks · page 1 of 2 · newest first · blends tagged

Records 1–300 of 565 · 1 supplier-provided, listed and left out of the benchmarks, most recent first.
Tested	Shop	Lab	Purity	Measured vs label	Endotoxin	Record
1 Oct 2026	Peptide Hackers	Accumark Labs	99.88%	4.75 / 10 mg 48% of labelCheck label	—	AM20260925-10✓
23 Sep 2026	Veratis Bio Peptides	freedomdiagnosticstesting.com	99.49%	11.36 / 10 mg 114% of label	Pass	TESA0001✓
22 Sep 2026	DNA Peptides	SideChain Analytics	99.60%	10.43 / 10 mg 104% of label	—	DNA-TESA10-2609-01✓
21 Sep 2026	ANKR Lab	freedomdiagnosticstesting.com	99.72%	11.19 / 10 mg 112% of label	Pass	1010✓
19 Sep 2026	NorthStar Compounds	Axiom Analytics	99.87%	10.68 / 10 mg 107% of label	Pass	TS12603✓
8 Sep 2026	Purely Peptides	Bioviridian	99.74%	10.35 / 10 mg 103% of label	—	TSM-20260828-01✓
3 Sep 2026	PSL Labs	Janoshik Labs	97.78%	9.91 / 10 mg 99% of label	—	PSL-TESA-10MG✓
2 Sep 2026	10 Bottle Value	BTLabs	99.80%	12.7 / 10 mg 127% of label	—	9mhy3wt
28 Aug 2026	Vistara Labs	—	99.79%	10.15 / 10 mg 102% of label	Pass	00011/0011
24 Aug 2026	NovaForge Labs	freedomdiagnosticstesting.com	99.03%	20.67 / 20 mg 103% of label	—	NFL-0002✓
24 Aug 2026	NovaForge Labs	freedomdiagnosticstesting.com	99.82%	10.56 / 10 mg 106% of label	—	NFL-0002✓
13 Aug 2026	Ramp Peptides	freedomdiagnosticstesting.com	99.95%	9.35 / 10 mg 94% of label	—	TSM10-RP03✓
12 Aug 2026	High Tide Compounds	Kovera Labs	99.52%	10.43 / 10 mg 104% of label	Pass	TES10-004✓
10 Aug 2026	NovaForge Labs	ILS Laboratories	99.78%	21.32 / 20 mg 107% of label	—	TSM-QSCT1✓
5 Aug 2026	PeptuviaSupplier-provided	freedomdiagnosticstesting.com	99.67%	9.43 / 10 mg 94% of label	—	2026072110✓
4 Aug 2026	Biotech Compounds	Bioviridian	99.84%	20.91 / 20 mg 105% of label	—	202609-01-TSM✓
3 Aug 2026	BioEdge Research Labs	Kovera Labs	99.75%	22.14 / 20 mg 111% of label	Pass	061826TESA20✓
3 Aug 2026	BioEdge Research Labs	Kovera Labs	99.70%	11.35 / 10 mg 114% of label	Pass	062026TES10✓
30 Jul 2026	NorthStar Compounds	freedomdiagnosticstesting.com	99.64%	6.21 / 10 mg 62% of labelCheck label	—	TS12602✓
29 Jul 2026	Drakon Peptides	Janoshik Labs	97.26%	9.83 / 10 mg 98% of label	Reported	DRK-TES-JUL26✓
28 Jul 2026	NovaForge Labs	ILS Laboratories	99.12%	10.64 / 10 mg 106% of label	—	2026-1✓
26 Jul 2026	Aigil Research	ILS Laboratories	99.76%	10.43 / 10 mg 104% of label	—	AG-TSM102✓
26 Jul 2026	Idun Peptides	Kovera Labs	99.44%	11.3 / 10 mg 113% of label	Pass	TS10-260626✓
25 Jul 2026	Glow Aminos	ILS Laboratories	99.63%	5.17 / 5 mg 103% of label	—	GL-010226✓
23 Jul 2026	Regenerative Research Peptides	BTLabs	99.70%	12.6 / 10 mg 126% of label	—	TS26-05
23 Jul 2026	Regenerative Research Peptides	BTLabs	99.70%	12 / 10 mg 120% of label	—	TS26-05
22 Jul 2026	Glow Aminos	ILS Laboratories	99.71%	10.48 / 10 mg 105% of label	—	GL-010221✓
21 Jul 2026	Peptide Foundry	freedomdiagnosticstesting.com	99.78%	11.32 / 10 mg 113% of label	Pass	FO226✓
21 Jul 2026	Peptime	freedomdiagnosticstesting.com	99.91%	11.39 / 10 mg 114% of label	—	71TE✓
20 Jul 2026	Phase One Labz	ILS Laboratories	99.81%	10.53 / 10 mg 105% of label	—	P1-10TES06✓
19 Jul 2026	Offline Peptides	freedomdiagnosticstesting.com	99.28%	5.93 / 5 mg 119% of label	—	OP-TSM5-0726✓
18 Jul 2026	Peptuvia	freedomdiagnosticstesting.com	99.87%	10.75 / 10 mg 108% of label	—	View record →
16 Jul 2026	Maple Research Labs	Testides	99.14%	4.83 / 5 mg 97% of label	—	5815✓
16 Jul 2026	Peptide Plugs	freedomdiagnosticstesting.com	99.86%	10.99 / 10 mg 110% of label	Pass	160-310X-DK✓
13 Jul 2026	Global Aminos	freedomdiagnosticstesting.com	99.73%	12.36 / 10 mg 124% of label	—	View record →
12 Jul 2026	Backroad Aminos	Kovera Labs	99.67%	11.58 / 10 mg 116% of label	Pass	BA07052026TSM10✓
10 Jul 2026	Curo	BTLabs	99.80%	24.6 / 20 mg 123% of label	—	TSM20ZO626
9 Jul 2026	Ascend Science	Kovera Labs	99.54%	11.38 / 10 mg 114% of label	—	C221H38M720KT5✓
9 Jul 2026	Ascend Science	Kovera Labs	99.63%	5.58 / 5 mg 112% of label	—	C221H38M720KT5✓
6 Jul 2026	Modified Aminos	Ethos Analytics	99.00%	20.93 / 20 mg 105% of label	Pass	MA-TESP-200
3 Jul 2026	Backroad Aminos	Kovera Labs	99.74%	11.81 / 10 mg 118% of label	Pass	LCA06222026TSM10✓
3 Jul 2026	High Tide Compounds	Kovera Labs	99.78%	11.32 / 10 mg 113% of label	Pass	TES10-003✓
3 Jul 2026	NuLife Peptides	freedomdiagnosticstesting.com	99.78%	11.67 / 10 mg 117% of label	Pass	NLTESA10501✓
2 Jul 2026	Wolverine Peptides	freedomdiagnosticstesting.com	99.72%	12.17 / 10 mg 122% of label	—	View record →
29 Jun 2026	Polaris Peptides	Accumark Labs	99.04%	8.44 / 10 mg 84% of label	—	POL-TESA10-9✓
29 Jun 2026	Studz Peptides	ILS Laboratories	99.42%	10.59 / 10 mg 106% of label	—	TSM10-0608-LIS✓
29 Jun 2026	Humatide PeptidesBlendTesamorelin/Ipamorelin 20mg/6mg Blend	ILS Laboratories	99.83%	27.72 / 26 mg 107% of label	—	H2006TSIP060126
28 Jun 2026	Studz Peptides	ILS Laboratories	99.80%	21.42 / 20 mg 107% of label	—	TSM20689-LIS✓
27 Jun 2026	Revitalized Research	Horizon Analytical	99.39%	10.21 / 10 mg 102% of label	—	RRL-1700427-P
27 Jun 2026	Humatide Peptides	ILS Laboratories	99.83%	20.64 / 20 mg 103% of label	—	H20TSM060126
24 Jun 2026	My Amino Lab	Kovera Labs	99.88%	11.19 / 10 mg 112% of label	—	V2606-TS10-2401✓
24 Jun 2026	Elevated Peptides	MZ Biolabs	99.61%	26.7 / 20 mg 134% of label	—	2026-06-16
24 Jun 2026	Silverstone Labs Co	ILS Laboratories	99.61%	19.84 / 20 mg 99% of label	Pass	TB22-0726✓
24 Jun 2026	AminoVault	ILS Laboratories	99.89%	10.33 / 10 mg 103% of label	—	AV-6162026-T✓
23 Jun 2026	EZ Peps	ILS Laboratories	99.58%	20.58 / 20 mg 103% of label	—	26-U5-CRTTE200522✓
22 Jun 2026	Ktechpeptide	Janoshik Labs	98.65%	11.28 / 10 mg 113% of label	—	2026-6✓
22 Jun 2026	Ascend Peptides AU	Ozcanium Analytics	99.29%	10.18 / 10 mg 102% of label	—	16/06/2026
22 Jun 2026	Veratis Bio Peptides	freedomdiagnosticstesting.com	99.82%	9.97 / 10 mg 100% of label	—	TES260618A✓
22 Jun 2026	Peptide Plugs	freedomdiagnosticstesting.com	99.81%	10.17 / 10 mg 102% of label	Pass	136-02-SM-WT✓
22 Jun 2026	24PeptidesBlendTesamorelin/Ipamorelin	liquilabs	99.80%	14.47 / 13 mg 111% of label	Reported	GF-TESAIAP10/3-B242
22 Jun 2026	Adria Science	liquilabs	99.80%	9.44 / 10 mg 94% of label	Pass	0012924
21 Jun 2026	Pep Club USA	freedomdiagnosticstesting.com	99.75%	5.79 / 5 mg 116% of label	—	View record →
20 Jun 2026	Research Chem HQ	Kovera Labs	99.41%	11.42 / 10 mg 114% of label	Pass	#HXM3A✓
19 Jun 2026	Peptide Partners	TrustPointe Analytics	99.80%	10.51 / 10 mg 105% of label	—	View record →
19 Jun 2026	Synova Supply	Horizon Analytical	99.37%	10.03 / 10 mg 100% of label	—	SS-3699671-P
17 Jun 2026	Optimum Formula	Kovera Labs	99.41%	11.42 / 10 mg 114% of label	Pass	#HXM3A✓
17 Jun 2026	Glow Aminos	ILS Laboratories	99.73%	10.53 / 10 mg 105% of label	—	GL-010162✓
17 Jun 2026	American Peptides	Bioviridian	99.90%	20.72 / 20 mg 104% of label	Pass	TESA20-0528
17 Jun 2026	American Peptides	Bioviridian	99.90%	10.66 / 10 mg 107% of label	Pass	TESA10-0528
16 Jun 2026	Blank Peptides	Horizon Analytical	99.37%	10.03 / 10 mg 100% of label	—	B-3699671-P
15 Jun 2026	Regenorix Peptides	liquilabs	99.80%	9.67 / 10 mg 97% of label	Reported	RGXTESA10-2606-01
15 Jun 2026	Blank Peptides	freedomdiagnosticstesting.com	99.62%	11.72 / 10 mg 117% of label	Pass	TES10-062026-1✓
15 Jun 2026	Oasis Labs	Bioviridian	99.90%	10.53 / 10 mg 105% of label	—	112455✓
15 Jun 2026	AMC Essentials	Kovera Labs	99.32%	21.16 / 20 mg 106% of label	Pass	AMC-TES2-01✓
15 Jun 2026	Honest Peptide	freedomdiagnosticstesting.com	99.85%	12.03 / 10 mg 120% of label	—	TSM1006102026✓
15 Jun 2026	LA Peptides	Bioviridian	99.90%	10.35 / 10 mg 103% of label	Pass	1318
14 Jun 2026	Nura Peptide	freedomdiagnosticstesting.com	99.93%	21.7 / 20 mg 109% of label	Pass	TESM20-062026-1✓
14 Jun 2026	Nura Peptide	freedomdiagnosticstesting.com	99.80%	11.54 / 10 mg 115% of label	Pass	TESM10-062026-1✓
14 Jun 2026	Rescue Research USA Peptides	freedomdiagnosticstesting.com	99.54%	10.48 / 10 mg 105% of label	Pass	WP-TS-2606
12 Jun 2026	Bluum Peptides	freedomdiagnosticstesting.com	99.47%	5.52 / 5 mg 110% of label	Pass	TES52606-92G
11 Jun 2026	Puratek Peptides	ILS Laboratories	99.76%	20.66 / 20 mg 103% of label	—	TES20002✓
11 Jun 2026	Voltera Sciences Peptides	ILS Laboratories	99.89%	10.45 / 10 mg 105% of label	—	TSM10-06022026✓
10 Jun 2026	PeptideRUO	freedomdiagnosticstesting.com	99.83%	22.74 / 10 mg 227% of labelCheck label	—	TM100521✓
8 Jun 2026	Modified Aminos	Ethos Analytics	99.00%	10.03 / 10 mg 100% of label	Pass	MA-TSP-101
6 Jun 2026	Elutide	ILS Laboratories	99.11%	21.17 / 20 mg 106% of label	—	ELU26008-TES20
4 Jun 2026	EZ Peps	ILS Laboratories	98.60%	21.08 / 20 mg 105% of label	—	26-U5-PRT / TE200513 / ACC-2026-3545✓
4 Jun 2026	Bluum Peptides	freedomdiagnosticstesting.com	99.17%	4.31 / 5 mg 86% of label	Pass	TES52605-80AL
3 Jun 2026	Orvella Labs	Kovera Labs	99.73%	10.2 / 10 mg 102% of label	Pass	TSM-Y29J1✓
3 Jun 2026	Glow Aminos	ILS Laboratories	99.77%	10.69 / 10 mg 107% of label	—	GL-010133✓
2 Jun 2026	Ascension Peptides	Kovera Labs	99.70%	5.56 / 5 mg 111% of label	Pass	32-05260628✓
2 Jun 2026	Proxiva Peptides	Vanguard Laboratory	98.20%	9.77 / 10 mg 98% of label	—	354
31 May 2026	Perfect Peptides	Chromate	99.63%	10.23 / 10 mg 102% of label	Pass	PP2420985✓
30 May 2026	Modern Research Peptides	freedomdiagnosticstesting.com	99.72%	5 / 5 mg 100% of label	Pass	GCRPM6262✓
30 May 2026	Modern Research Peptides	freedomdiagnosticstesting.com	99.78%	9.91 / 10 mg 99% of label	Pass	EM93341✓
30 May 2026	Elutide	ILS Laboratories	98.50%	10.57 / 10 mg 106% of label	—	ELU26008-TES10
29 May 2026	Peptide Maxxing	freedomdiagnosticstesting.com	99.46%	9.08 / 10 mg 91% of label	—	TES927✓
29 May 2026	Alyve Peptides	freedomdiagnosticstesting.com	99.46%	9.08 / 10 mg 91% of label	—	TES927✓
29 May 2026	EVO Labs Research	Kovera Labs	99.71%	10.76 / 10 mg 108% of label	—	EVO5213026
28 May 2026	Backroad Aminos	Kovera Labs	99.44%	22.31 / 20 mg 112% of label	Pass	BA0626TSM20✓
28 May 2026	Peptide Partners	TrustPointe Analytics	99.81%	10.09 / 10 mg 101% of label	—	View record →
28 May 2026	Imagine First Labs	Horizon Analytical	99.19%	10.12 / 10 mg 101% of label	—	IFL-7980975-P
28 May 2026	Studz Peptides	Kovera Labs	99.96%	10.93 / 10 mg 109% of label	Pass	TES10-051926-BOB✓
27 May 2026	Good ScienceBlendTesamorelin/Ipamorelin	Vanguard Laboratory	99.10%	15.55 / 15 mg 104% of label	Pass	3548687
27 May 2026	Good Science	Vanguard Laboratory	99.07%	10.37 / 10 mg 104% of label	Pass	3548429
27 May 2026	Good Science	Vanguard Laboratory	99.20%	20.51 / 20 mg 103% of label	Pass	3548435
27 May 2026	Good Science	Vanguard Laboratory	99.00%	5.23 / 5 mg 105% of label	Pass	3548423
27 May 2026	Good Science	Vanguard Laboratory	99.03%	5.29 / 5 mg 106% of label	—	3548423
26 May 2026	High Tide Compounds	Kovera Labs	99.24%	10.34 / 10 mg 103% of label	Pass	TES10-002✓
26 May 2026	Snap Peptides	Kovera Labs	99.82%	10.8 / 10 mg 108% of label	Pass	SP26-TESA10-04✓
21 May 2026	TriVial BioWorks	Kovera Labs	98.93%	11.26 / 10 mg 113% of label	Pass	TS10-0511✓
21 May 2026	Midwest Peptide	freedomdiagnosticstesting.com	99.50%	9.86 / 10 mg 99% of label	—	MPTA004
20 May 2026	Synthesis Peptides	Kovera Labs	99.36%	10.24 / 10 mg 102% of label	—	TSI0626
20 May 2026	Instant PeptidesBlendTesamorelin/Ipamorelin	Kovera Labs	99.71%	18.14 / 16 mg 113% of label	—	2026-0310-A
19 May 2026	Silverstone Labs Co	ILS Laboratories	99.51%	20.81 / 20 mg 104% of label	Pass	TE20-0526✓
19 May 2026	Silverstone Labs Co	ILS Laboratories	99.49%	10.33 / 10 mg 103% of label	Pass	TE10-0526✓
19 May 2026	EZ Peps	ILS Laboratories	99.51%	12.39 / 12 mg 103% of label	—	26-U4-BBT/TE100422✓
19 May 2026	Purity Peptides	MDx BioAnalytical Laboratory	99.76%	10.17 / 10 mg 102% of label	Pass	View record →
18 May 2026	Protide Health	freedomdiagnosticstesting.com	99.77%	12.39 / 10 mg 124% of label	Pass	PH-te10-0408
18 May 2026	Protide Health	freedomdiagnosticstesting.com	99.84%	23.25 / 20 mg 116% of label	Pass	PH-te20-0305
18 May 2026	Excalibur Peptides	BTLabs	99.60%	11.9 / 10 mg 119% of label	—	Y2KF8FH
18 May 2026	Instant Peptides	Kovera Labs	99.88%	10.69 / 10 mg 107% of label	—	2026-0239-B
17 May 2026	Bluum Peptides	freedomdiagnosticstesting.com	99.76%	9.75 / 10 mg 98% of label	—	TES102605-81A
16 May 2026	Valor Peptides	Accumark Labs	99.58%	34.5 / 32 mg 108% of label	—	ARC-TS32-001
15 May 2026	Research Chem HQ	ILS Laboratories	99.61%	10.44 / 10 mg 104% of label	—	#ERT3N✓
15 May 2026	Glacier Aminos	ILS Laboratories	99.77%	10.4 / 10 mg 104% of label	—	TES10GA-07
14 May 2026	Vertex Labs	BTLabs	99.40%	12.2 / 10 mg 122% of label	—	TS0000043
14 May 2026	Zen Aminos	freedomdiagnosticstesting.com	99.82%	12.25 / 10 mg 123% of label	—	View record →
12 May 2026	Warrior Makers	MZ Biolabs	99.92%	not reported	—	11238-SG51
12 May 2026	Puratek Peptides	freedomdiagnosticstesting.com	99.80%	10.33 / 10 mg 103% of label	Pass	TES10005✓
12 May 2026	EZ Peps	ILS Laboratories	99.63%	20.43 / 20 mg 102% of label	—	TE200412 / ACC-2026-1974✓
12 May 2026	LA Peptides	Bioviridian	99.90%	11.54 / 10 mg 115% of label	Pass	1218
12 May 2026	NG PeptideBlendTesamorelin/Ipamorelin/CJC-1295	ILS Laboratories	99.92%	16.42 / 16 mg 103% of label	—	TIC338-01
11 May 2026	Kalyx Labs	freedomdiagnosticstesting.com	99.78%	11.95 / 10 mg 119% of label	—	TSM10-B01✓
11 May 2026	Rescue Research USA Peptides	freedomdiagnosticstesting.com	99.72%	11.03 / 10 mg 110% of label	—	View record →
11 May 2026	PeptidePro Canada	Janoshik Labs	99.50%	11.64 / 10 mg 116% of label	—	2511-3-252
11 May 2026	Peptify UK	Janoshik Labs	99.09%	10.78 / 10 mg 108% of label	—	2026/04
10 May 2026	NG Peptide	ILS Laboratories	99.48%	20.71 / 20 mg 104% of label	—	TSM20-3
8 May 2026	Synthesis Peptides	freedomdiagnosticstesting.com	99.87%	20.54 / 20 mg 103% of label	—	View record →
7 May 2026	Petratide Science	freedomdiagnosticstesting.com	99.32%	20.71 / 20 mg 104% of label	—	PS05-TSM20
7 May 2026	Oath PeptidesBlendTesamorelin/Ipamorelin	freedomdiagnosticstesting.com	99.21%	11.96 / 10 mg 120% of label	Pass	B9520
7 May 2026	Reta One Labs	Kovera Labs	99.94%	11.31 / 10 mg 113% of label	Pass	TS100526
7 May 2026	Reta One Labs	Kovera Labs	99.89%	22.45 / 20 mg 112% of label	Pass	TS200526
6 May 2026	Glowing Peptides	Janoshik Labs	99.04%	10.38 / 10 mg 104% of label	—	C119
6 May 2026	RUO.bio	Vanguard Laboratory	99.80%	9.84 / 10 mg 98% of label	—	TSA101
5 May 2026	Glow Aminos	ILS Laboratories	99.57%	10.47 / 10 mg 105% of label	—	GL-010105✓
4 May 2026	PeptideRUO	freedomdiagnosticstesting.com	99.73%	10.62 / 10 mg 106% of label	—	TM100401✓
4 May 2026	Panda Peptides	Janoshik Labs	99.20%	10.65 / 10 mg 107% of label	—	PP2602-039B
4 May 2026	Chameleon PeptidesClosed	Janoshik Labs	99.20%	10.65 / 10 mg 107% of label	—	B002
2 May 2026	Gentleman Peptides	Bioviridian	99.90%	10.36 / 10 mg 104% of label	—	View record →
1 May 2026	Oneday Compounds	Vanguard Laboratory	99.80%	11.89 / 10 mg 119% of label	—	OC-TSM10-104
1 May 2026	Protide Health	freedomdiagnosticstesting.com	99.62%	11.32 / 10 mg 113% of label	Pass	PH-TE10-0111
30 Apr 2026	GenPeptide	Chromate	99.04%	11.01 / 10 mg 110% of label	—	GPTES10042226✓
29 Apr 2026	Oneday Compounds	Vanguard Laboratory	99.80%	9.75 / 10 mg 98% of label	—	OC-TSM10-103
28 Apr 2026	Core Peptides	Vanguard Laboratory	99.78%	10 / 10 mg 100% of label	—	C73528✓
28 Apr 2026	Core Peptides	Vanguard Laboratory	99.80%	5 / 5 mg 100% of label	—	View record →
28 Apr 2026	TruLab Peptides	freedomdiagnosticstesting.com	99.92%	5.57 / 5 mg 111% of label	—	Poly2604270323
27 Apr 2026	BioLongevity Labs	MDx BioAnalytical Laboratory	99.77%	10.16 / 10 mg 102% of label	Pass	28-3-46136
26 Apr 2026	Peptide Minds	freedomdiagnosticstesting.com	99.90%	11.17 / 10 mg 112% of label	—	PM-04236✓
26 Apr 2026	Felix Chemical Supply	freedomdiagnosticstesting.com	99.86%	11.85 / 10 mg 119% of label	Pass	042326-TS1-1
25 Apr 2026	Studz Peptides	Kovera Labs	99.82%	21.73 / 20 mg 109% of label	—	TSM20-04192026-LIS✓
24 Apr 2026	Stratford Peptides	Analiza Białek	99.00%	10.28 / 10 mg 103% of label	—	100014070
23 Apr 2026	Precisely Peptides	Vanguard Laboratory	99.80%	5.23 / 5 mg 105% of label	—	PP412-26-001
23 Apr 2026	Valor Peptides	Accumark Labs	99.32%	10.88 / 10 mg 109% of label	—	ARC-TS10-002
22 Apr 2026	Riptide WellnessBlendTesamorelin/Ipamorelin	ILS Laboratories	99.83%	16.77 / 13 mg 129% of label	Reported	RWTSI-14-1006
22 Apr 2026	Riptide Wellness	ILS Laboratories	99.73%	10.47 / 10 mg 105% of label	Pass	RWTES-10-1084
22 Apr 2026	24Peptides	liquilabs	99.80%	20.8 / 20 mg 104% of label	Pass	GF-TESA20-B241
22 Apr 2026	24Peptides	liquilabs	99.80%	10.74 / 10 mg 107% of label	Pass	GF-TESA10-B241
22 Apr 2026	Bluum Peptides	freedomdiagnosticstesting.com	99.74%	21.54 / 20 mg 108% of label	Pass	TES202903-1K
22 Apr 2026	Disguised Alpha	Chromate	99.63%	10.37 / 10 mg 104% of label	Pass	FX35
21 Apr 2026	Peptide Partners	Kovera Labs	99.85%	11.61 / 10 mg 116% of label	Pass	TES202604
21 Apr 2026	Coffee and Peppers	freedomdiagnosticstesting.com	99.24%	22.77 / 20 mg 114% of label	Pass	CPTESA26041501
21 Apr 2026	Coffee and Peppers	freedomdiagnosticstesting.com	99.03%	11.07 / 10 mg 111% of label	Pass	CPTE55A1026041605
20 Apr 2026	Vertex Labs	BTLabs	99.20%	5.5 / 10 mg 55% of labelCheck label	—	TS000042
20 Apr 2026	NovaCell Peptides	liquilabs	99.80%	9.48 / 10 mg 95% of label	—	TE-022601
20 Apr 2026	Amplified Labs	Bioviridian	99.80%	11.06 / 10 mg 111% of label	—	TES-E10ZZ03
18 Apr 2026	Zen Aminos	freedomdiagnosticstesting.com	99.89%	10.39 / 10 mg 104% of label	—	ZATS03
18 Apr 2026	NG Peptide	ILS Laboratories	99.40%	10.44 / 10 mg 104% of label	—	TSM11
17 Apr 2026	True Research Labs	Horizon Analytical	99.23%	10.13 / 10 mg 101% of label	—	TRL-4867057
17 Apr 2026	Elutide	Horizon Analytical	99.23%	10.13 / 10 mg 101% of label	—	E-4867057-P
17 Apr 2026	Felix Chemical Supply	freedomdiagnosticstesting.com	99.71%	5.9 / 5 mg 118% of label	Pass	041326-TS5-0
16 Apr 2026	Ramp Peptides	freedomdiagnosticstesting.com	99.89%	12.18 / 10 mg 122% of label	Pass	TSM10-RP02✓
16 Apr 2026	PepGenics Research	freedomdiagnosticstesting.com	99.92%	10.75 / 10 mg 108% of label	—	PGR-TE10990055✓
16 Apr 2026	NG PeptideBlendTesamorelin/Ipamorelin	ILS Laboratories	99.98%	13.65 / 13 mg 105% of label	—	TS/PA-1736
15 Apr 2026	NextEdge Peptides	Janoshik Labs	99.03%	4.3 / 5 mg 86% of label	—	TESA5-92504✓
15 Apr 2026	Petratide Science	freedomdiagnosticstesting.com	99.93%	10.47 / 10 mg 105% of label	—	View record →
15 Apr 2026	Oath PeptidesBlendTesamorelin/Ipamorelin	freedomdiagnosticstesting.com	99.61%	9.99 / 6 mg 167% of labelCheck label	Pass	B1326066
15 Apr 2026	Reta One Labs	Kovera Labs	99.92%	11.1 / 10 mg 111% of label	Pass	TS100326
15 Apr 2026	Nova Peptide Supply	freedomdiagnosticstesting.com	99.85%	9.7 / 10 mg 97% of label	Pass	View record →
14 Apr 2026	PepGenics Research	freedomdiagnosticstesting.com	99.96%	24.61 / 20 mg 123% of label	—	TE20031726✓
14 Apr 2026	Peptide Lab EU	Janoshik Labs	99.74%	10.31 / 10 mg 103% of label	—	24th Feb 2026✓
14 Apr 2026	Midshire Labs (formerly Regen Peptides)	Janoshik Labs	99.78%	11.36 / 10 mg 114% of label	—	JP20260816
12 Apr 2026	Pure Health Peptides	Ethos Analytics	99.00%	10.17 / 10 mg 102% of label	—	TUY-040126
11 Apr 2026	Glow Aminos	ILS Laboratories	99.84%	10.48 / 10 mg 105% of label	Pass	GL-010086✓
10 Apr 2026	Nova BioLabs Peptides	Janoshik Labs	99.30%	10.79 / 10 mg 108% of label	—	NVTE10-01042026
9 Apr 2026	Nura Peptide	freedomdiagnosticstesting.com	99.02%	11.48 / 10 mg 115% of label	—	TES10-04926✓
9 Apr 2026	Peppy&Me	Krause Analytical	99.90%	10.92 / 10 mg 109% of label	—	PMTS102603A
9 Apr 2026	Peak Peptides Rancho Cucamonga	Analytical Formulations Inc	99.40%	11.91 / 10 mg 119% of label	—	Tesa-10-0426
9 Apr 2026	Peak Peptides Rancho Cucamonga	Analytical Formulations Inc	99.40%	22.54 / 20 mg 113% of label	—	Tesa-20-0426
8 Apr 2026	Andy Peps Studio (APS) Peptides	Janoshik Labs	99.74%	11.66 / 10 mg 117% of label	—	View record →
8 Apr 2026	Polaris Peptides	TrustPointe Analytics	99.15%	11.17 / 10 mg 112% of label	—	POL-TESA10-8✓
8 Apr 2026	Omegamino	freedomdiagnosticstesting.com	99.08%	12.54 / 10 mg 125% of label	—	1001
7 Apr 2026	High Tide Compounds	freedomdiagnosticstesting.com	99.02%	11.59 / 10 mg 116% of label	—	TES10-001✓
7 Apr 2026	PeptideTech	freedomdiagnosticstesting.com	99.16%	10.43 / 10 mg 104% of label	Pass	TES10-6230✓
7 Apr 2026	Blank Peptides	freedomdiagnosticstesting.com	99.08%	10.58 / 10 mg 106% of label	—	665394
7 Apr 2026	Nova Peptide Supply	freedomdiagnosticstesting.com	99.27%	20.54 / 20 mg 103% of label	Pass	2604070022
4 Apr 2026	Glacier Aminos	Kovera Labs	99.94%	10.77 / 10 mg 108% of label	Pass	TES10GA-08
3 Apr 2026	HYTE Research Division	freedomdiagnosticstesting.com	99.18%	11.56 / 10 mg 116% of label	—	202603TSM10✓
3 Apr 2026	American Peptides	Bioviridian	99.80%	11.71 / 10 mg 117% of label	Pass	TESA10-0318
2 Apr 2026	Bluum Peptides	freedomdiagnosticstesting.com	99.06%	11.7 / 10 mg 117% of label	—	210911
2 Apr 2026	Pure Health Peptides	BioRegen	99.25%	12.32 / 10 mg 123% of label	—	TUY-030926
2 Apr 2026	Elite Research USABlendTesamorelin/Ipamorelin	BioRegen	99.62%	11.08 / 10 mg 111% of label	—	104125SY0326
2 Apr 2026	Felix Chemical Supply	freedomdiagnosticstesting.com	99.27%	12.91 / 10 mg 129% of label	Pass	033126-TS1-6 Green
2 Apr 2026	Peptira	freedomdiagnosticstesting.com	99.07%	12.19 / 10 mg 122% of label	—	TESA10-008
1 Apr 2026	EZ Peptides	Janoshik Labs	99.84%	11.22 / 10 mg 112% of label	—	EZP-TES1003212026-20✓
1 Apr 2026	Ameano Peptides	Janoshik Labs	99.84%	11.17 / 10 mg 112% of label	—	TES1003212026-20✓
1 Apr 2026	Nexaph	Janoshik Labs	99.86%	11.17 / 10 mg 112% of label	—	TES1003212026-20
31 Mar 2026	DS Research Peptides	freedomdiagnosticstesting.com	99.08%	12.67 / 10 mg 127% of label	Pass	60043
31 Mar 2026	Profound AminosBlendTesamorelin/Ipamorelin	TrustPointe Analytics	99.12%	5.21 / 5 mg 104% of label	—	SP-3281
31 Mar 2026	PeptidologyBlendTesamorelin/CJC-1295/Ipamorelin	Vanguard Laboratory	99.50%	11.55 / 12 mg 96% of label	—	1672
30 Mar 2026	Optimum Formula	Kovera Labs	99.94%	11.41 / 10 mg 114% of label	Pass	UOJ33✓
30 Mar 2026	Research Chem HQ	Kovera Labs	99.94%	11.41 / 10 mg 114% of label	Pass	UOJ33✓
30 Mar 2026	Simply Peptides	Analiza Białek	99.00%	5.39 / 5 mg 108% of label	—	1125051
30 Mar 2026	Pure Health Peptides	Ethos Analytics	99.00%	5.27 / 5 mg 105% of label	—	TUY-030926
30 Mar 2026	VRIL Peptides	Janoshik Labs	99.05%	10.2 / 10 mg 102% of label	—	20260311
29 Mar 2026	Peptinexia	BTLabs	99.70%	9.1 / 10 mg 91% of label	—	TES0100304261
28 Mar 2026	Plum Labs Research	freedomdiagnosticstesting.com	99.06%	13.34 / 10 mg 133% of label	Pass	PLR-TS-101✓
28 Mar 2026	Glacier Aminos	Kovera Labs	99.89%	22.2 / 20 mg 111% of label	Pass	TES20GA-03
27 Mar 2026	Valor PeptidesBlendTesamorelin/Ipamorelin	Accumark Labs	98.34%	17.57 / 15 mg 117% of label	—	TIP0001
27 Mar 2026	Skye Peptides	Janoshik Labs	99.48%	25.8 / 20 mg 129% of label	—	TESA26-20-003
26 Mar 2026	Vylix Research	freedomdiagnosticstesting.com	99.04%	12.37 / 10 mg 124% of label	—	View record →
25 Mar 2026	GenPeptide	Chromate	99.39%	11.48 / 10 mg 115% of label	—	GPTES10030526✓
25 Mar 2026	Peptide Partners	TrustPointe Analytics	99.51%	9.66 / 10 mg 97% of label	—	TES202603
23 Mar 2026	Skye Peptides	Janoshik Labs	99.70%	26.65 / 20 mg 133% of label	—	TESA26-20-002
22 Mar 2026	Elutide	Horizon Analytical	99.19%	10.05 / 10 mg 101% of label	—	E-6999761
22 Mar 2026	Amino Forge	Horizon Analytical	99.39%	10.18 / 10 mg 102% of label	—	A-5750148
22 Mar 2026	Mile High Compounds	Kovera Labs	99.93%	10.53 / 30 mg 35% of labelCheck label	—	TES-030-MH-03
20 Mar 2026	Simon's Compounding	Bioviridian	99.75%	9.78 / 10 mg 98% of label	—	View record →
20 Mar 2026	Tydes	Janoshik Labs	99.83%	26.95 / 20 mg 135% of label	—	TES20031126
19 Mar 2026	Everest Peptides	freedomdiagnosticstesting.com	99.16%	21.91 / 20 mg 110% of label	—	EVR-TESA20-2603-001
19 Mar 2026	Pure Health Peptides	Ethos Analytics	99.00%	5.19 / 5 mg 104% of label	—	TUY-022626
19 Mar 2026	Pure Health Peptides	Ethos Analytics	99.00%	10.26 / 10 mg 103% of label	—	TUY-022626
19 Mar 2026	Peptira	freedomdiagnosticstesting.com	99.70%	12.37 / 10 mg 124% of label	Pass	TESA10-007
18 Mar 2026	Biopeptitech	Accurate Test Lab	99.52%	10.5 / 10 mg 105% of label	—	110022
18 Mar 2026	Biopeptitech	Accurate Test Lab	99.59%	5.2 / 5 mg 104% of label	—	110021
16 Mar 2026	Ion Peptide	Analytical Formulations Inc	99.60%	11 / 10 mg 110% of label	—	TESA10-03112026
12 Mar 2026	Valor Peptides	Accumark Labs	99.47%	11.63 / 10 mg 116% of label	—	TEL0002
11 Mar 2026	Go Alpha Labs	freedomdiagnosticstesting.com	99.51%	11.71 / 10 mg 117% of label	—	LO07-10
10 Mar 2026	Enhanced Peptides	Vanguard Laboratory	99.75%	2.25 / 2 mg 113% of label	—	TS45-6821
10 Mar 2026	Vi Corpus	Janoshik Labs	99.99%	11.06 / 10 mg 111% of label	—	VCAU26.1
10 Mar 2026	Mile High CompoundsBlendTesamorelin/Ipamorelin	Vanguard Laboratory	99.06%	12.47 / 13 mg 96% of label	—	TIB-013-MH-01
10 Mar 2026	Peptide Supply Co	freedomdiagnosticstesting.com	99.53%	21.9 / 20 mg 110% of label	—	TSM20030526
9 Mar 2026	Vantyx Research	freedomdiagnosticstesting.com	97.20%	9.9 / 10 mg 99% of label	—	TESA-2603-A
6 Mar 2026	Glow Aminos	freedomdiagnosticstesting.com	99.72%	12.33 / 10 mg 123% of label	Pass	GL-010054✓
5 Mar 2026	LA Peptides	Bioviridian	99.70%	11.14 / 10 mg 111% of label	Pass	818
5 Mar 2026	Glacier AminosBlendTesamorelin/Ipamorelin	Kovera Labs	99.85%	14.38 / 15 mg 96% of label	—	TEMGA-03
5 Mar 2026	Nova Peptide Supply	freedomdiagnosticstesting.com	99.56%	12.41 / 12 mg 103% of label	Pass	N3-E-EH6
5 Mar 2026	Felix Chemical Supply	freedomdiagnosticstesting.com	98.66%	7 / 5 mg 140% of label	Pass	030226-TS5-1 (blue)
5 Mar 2026	Atomik Labz	BioRegen	99.76%	10.09 / 10 mg 101% of label	Pass	TM22726
3 Mar 2026	Peptide Koning	Axiom Analytics	99.64%	10.95 / 10 mg 110% of label	Pass	PK-RG-009
2 Mar 2026	BioCollex Research	freedomdiagnosticstesting.com	99.77%	13.17 / 10 mg 132% of label	—	04920✓
2 Mar 2026	Ion PeptideBlendTesamorelin/Ipamorelin	freedomdiagnosticstesting.com	99.42%	16.15 / 13 mg 124% of label	Pass	TIB13-02272026
28 Feb 2026	True Research Labs	Horizon Analytical	99.34%	9.9 / 10 mg 99% of label	—	TRL-8738730
28 Feb 2026	Zen Aminos	Horizon Analytical	99.34%	9.9 / 10 mg 99% of label	—	ZA-8738730
28 Feb 2026	Peptide ProsBlendTesamorelin/Ipamorelin	Bioviridian	99.70%	15.54 / 15 mg 104% of label	—	TEI/P21526
28 Feb 2026	Direct Peptides	Horizon Analytical	99.34%	9.9 / 10 mg 99% of label	—	DPS-8738730
27 Feb 2026	AminoQuest Labs	freedomdiagnosticstesting.com	99.01%	12.76 / 10 mg 128% of label	—	AQ-TSM10-226-M
27 Feb 2026	Mile High Compounds	Kovera Labs	99.92%	11.9 / 10 mg 119% of label	—	TES-050-MH-02
27 Feb 2026	Reta One Labs	Vanguard Laboratory	99.12%	9.69 / 10 mg 97% of label	—	TS100326
27 Feb 2026	Mile High Compounds	Kovera Labs	99.84%	11.58 / 10 mg 116% of label	Pass	TES-010-MH-02
26 Feb 2026	Optimum Aminos	freedomdiagnosticstesting.com	99.58%	13.3 / 10 mg 133% of label	—	TSM-26A✓
26 Feb 2026	Glow Aminos	freedomdiagnosticstesting.com	99.30%	6.6 / 5 mg 132% of label	Pass	GL-010048✓
26 Feb 2026	Cosmic Peptides	Bioviridian	99.70%	5.25 / 5 mg 105% of label	—	26113
26 Feb 2026	Verified Peptides	Janoshik Labs	99.76%	23.42 / 23 mg 102% of label	—	TMD03260820H
25 Feb 2026	Evolve Biopep	Vanguard Laboratory	99.80%	14.17 / 13 mg 109% of label	—	TILO3226
24 Feb 2026	Pure U.S. Peptides	Vanguard Laboratory	99.80%	9.96 / 10 mg 100% of label	Pass	T26C902
24 Feb 2026	Blank Peptides	freedomdiagnosticstesting.com	99.19%	12.88 / 10 mg 129% of label	Pass	71096-P
24 Feb 2026	Peptidology	Vanguard Laboratory	99.46%	11.5 / 10 mg 115% of label	—	1669
23 Feb 2026	Elite Research USA	BioRegen	99.74%	10.32 / 10 mg 103% of label	—	4999SY0226
22 Feb 2026	Glow Aminos	freedomdiagnosticstesting.com	99.43%	15.32 / 10 mg 153% of labelCheck label	—	GL-010035✓
22 Feb 2026	Ignite Peptides	freedomdiagnosticstesting.com	99.08%	10.6 / 10 mg 106% of label	—	IGP-TM10-19284✓
21 Feb 2026	EZ Peps	freedomdiagnosticstesting.com	99.46%	27.11 / 20 mg 136% of label	—	26-U2-BBT / TE200203✓
21 Feb 2026	EZ Peps	freedomdiagnosticstesting.com	99.58%	13.87 / 10 mg 139% of label	—	26-U1-YBT / TE100128✓
21 Feb 2026	Prosperity Peptides	freedomdiagnosticstesting.com	99.63%	14.19 / 10 mg 142% of label	—	TESA10-001
20 Feb 2026	Marvel Peptides	freedomdiagnosticstesting.com	99.40%	13.51 / 10 mg 135% of label	—	01107✓
20 Feb 2026	Oneday Compounds	Vanguard Laboratory	99.80%	10.23 / 10 mg 102% of label	—	OC-TSM10-102
19 Feb 2026	Luxara Labs	Testides	99.88%	21.88 / 10 mg 219% of labelCheck label	—	View record →
19 Feb 2026	Growth Guys	Janoshik Labs	99.89%	11.73 / 10 mg 117% of label	—	TES06
18 Feb 2026	Signum Scientific	Horizon Analytical	99.41%	10.12 / 10 mg 101% of label	—	TSM-10-02
18 Feb 2026	Rivn Peptides	freedomdiagnosticstesting.com	99.91%	6.09 / 5 mg 122% of label	—	6266
18 Feb 2026	Evolve Biopep	Vanguard Laboratory	99.80%	9.83 / 10 mg 98% of label	—	TS10126
18 Feb 2026	NG Peptide	freedomdiagnosticstesting.com	99.49%	13.19 / 10 mg 132% of label	Pass	TSM089-26
18 Feb 2026	Direct Peptides	Horizon Analytical	99.41%	10.12 / 10 mg 101% of label	—	DPS-8688689
17 Feb 2026	TriVial BioWorks	Chromate	99.23%	10.52 / 10 mg 105% of label	Reported	TS10-0213✓
17 Feb 2026	Full Scale Peptides	freedomdiagnosticstesting.com	99.28%	12.77 / 10 mg 128% of label	—	FSP-TESAMO-0126-A✓
17 Feb 2026	Protide Health	freedomdiagnosticstesting.com	99.48%	14.52 / 10 mg 145% of label	—	CS-te101021
16 Feb 2026	Amino Tech	freedomdiagnosticstesting.com	99.29%	13.28 / 10 mg 133% of label	—	View record →
16 Feb 2026	Amino Tech	freedomdiagnosticstesting.com	99.38%	6.88 / 5 mg 138% of label	—	View record →
16 Feb 2026	Grey Market Peptide	freedomdiagnosticstesting.com	99.29%	13.28 / 10 mg 133% of label	—	View record →
16 Feb 2026	Grey Market Peptide	freedomdiagnosticstesting.com	99.38%	6.88 / 5 mg 138% of label	—	View record →
16 Feb 2026	Peptide Crafters	Janoshik Labs	99.89%	10.76 / 10 mg 108% of label	—	PC-G2-TS10

Measured amount in amber when it is under 90% or over 130% of the label; Check label when it is under 80% or over 150%. Records without a lot number link as View →. Blend and other-form rows keep their place and page; they are tagged and left out of the figures above, because a blend certificate reports one purity and one amount for the whole vial. Blends with their own page: Tesamorelin + Ipamorelin lab tests (34)

Seven checks for any Tesamorelin certificate

The same seven questions decide whether a certificate of analysis means anything, whichever compound it describes. Six are about the document; the seventh is about what no document can tell you.

An independent, batch-matched COA. The certificate must name the batch or lot in your hands, and must come from a laboratory the vendor neither owns nor pays. A specimen certificate from an earlier lot proves nothing about the vial you were sent.
HPLC purity, read against a known band. A purity figure is only informative against the distribution for that compound. "Above 98%" is not a claim — the useful question is whether the result sits inside the range the rest of the market reports. How to read HPLC and mass-spec results.
Mass-spectrometry identity. HPLC says how much of the sample is one thing; it does not say which thing. Only a mass-spec result establishes identity, and it is the only check that separates compounds a few daltons apart. Contamination is not hypothetical: research-grade custom peptides from two independent commercial suppliers were found to carry contaminating peptides at roughly 1% by weight, enough to produce false-positive results in immunology assays (Clinical and Vaccine Immunology, 2008 — a study of HIV vaccine peptide libraries rather than of any compound on this site).
Net content, measured rather than assumed. Purity and quantity are different questions: a vial can be 99.7% pure and still contain two thirds of the labelled mass. Why 10 mg isn't 10 mg.
Endotoxin (LAL) on the batch. An absent endotoxin line means the batch was not tested — not that it passed. Endotoxin testing and LAL interpretation.
Who ran the test, and what they left off. A laboratory with a record on this compound, named on the certificate, with a verification route back to it. Testing laboratories we track · Red flags in a certificate of analysis.
What no test on the vial can establish. A perfect certificate confirms that a vendor sold the correct molecule at the stated quantity. It says nothing about efficacy, dosing, or long-term safety.

Want a vial tested yourself? How to send a peptide for independent HPLC testing.