Sermorelin: The Only GH Peptide FDA Ever Approved, and What That Approval Actually Covered

Sermorelin is the only growth hormone peptide FDA has ever approved — twice, in 1990 and 1997, both times for diagnostics and children. The one controlled trial in older adults found no change in IGF-1, body fat, lean mass or weight.

That pedigree is real and it is being used to sell something it does not cover. Sermorelin is also the only compound in the growth hormone peptides category absent from FDA's list of bulk substances that may present significant safety risks — where CJC-1295, ipamorelin, GHRP-2, GHRP-6 and twenty-odd others sit. For reconstitution arithmetic, use the peptide dosing calculator alongside the reconstitution calculator.

What was sermorelin approved for, and when?

Sermorelin was approved twice, for two narrow indications, neither of them adult body composition. Geref Diagnostic (NDA 019863) was approved on 28 December 1990 for "evaluating the ability of the somatotroph of the pituitary gland to secrete growth hormone." Geref (NDA 020443) followed on 26 September 1997 for "the treatment of idiopathic growth hormone deficiency (GHD) in children with growth failure." Both were sponsored by EMD Serono. Diagnostic first, paediatric therapeutic seven years later.

Most accounts of this get the details wrong. The common shorthand that "sermorelin was approved for paediatric growth hormone deficiency" is half the story and usually attaches the wrong date. The primary source is the Federal Register of 4 March 2013 (78 FR 14095–14096), FDA's formal determination on the Geref withdrawals.

Neither indication is adult. Neither is body composition. Neither is anti-ageing.

Was sermorelin withdrawn because it was unsafe?

No — and FDA said so in writing. EMD Serono notified the agency of discontinuation in letters dated 11 July 2008 (diagnostic) and 2 December 2008 (therapeutic), requested withdrawal of NDA 019863 on 12 December 2008, and FDA withdrew both approvals effective 18 June 2009. In 2013, responding to a citizen petition, FDA determined that the Geref products "were not withdrawn for reasons of safety or effectiveness" — a formal finding whose express purpose was to clear the way for generic applications.

No generic was ever approved. A search of FDA's own drug application database returns exactly two sermorelin applications: the original two, both discontinued.

That is the honest shape of it. A drug was approved, sold and discontinued commercially. FDA confirmed there was nothing wrong with it. Nobody wanted to make it.

There is a real cost buried in that sequence. The Endocrine Society's 2011 clinical practice guideline records it directly: "The production of the only commercially available formulation of GHRH in the United States was discontinued in 2008, making it at least temporarily unavailable." By 2019, guidelines listed the GHRH-arginine test as "no recommendation as not commercially available in the United States." Geref's commercial withdrawal removed a guideline-grade diagnostic from American endocrinology — and the same molecule is now sold by the milligram on wellness sites.

Why can pharmacies compound sermorelin when CJC-1295 and ipamorelin cannot be compounded?

Because sermorelin satisfies a statutory prong that the others do not. Under 21 U.S.C. § 353a(b)(1)(A), a bulk substance used in 503A compounding must do one of three things: comply with a USP monograph, be a component of an FDA-approved drug, or appear on FDA's 503A bulks list. Sermorelin has no USP monograph and is not on the bulks list — which contains six substances, none of them peptides, and sermorelin was never even nominated. It qualifies under the second prong.

FDA's own 503B bulk substances documentation lists "Sermorelin Acetate" with a footnote marking it as a substance that is a component of FDA approved drugs. That footnote is the strongest direct evidence of the agency's operative position.

One honest caveat belongs here. Both Geref approvals were formally withdrawn in 2009, and we found no FDA document expressly resolving whether a withdrawn approval still satisfies that prong. The footnote implies the agency's answer; the final inferential step is not spelled out in an FDA statement, and we are not going to pretend otherwise.

What sermorelin is not on. FDA's page of bulk substances that may present significant safety risks — content current 22 April 2026 — carries two tables. The active Category 2 list holds fourteen substances, and the peptides among them are GHRP-2, GHRP-6, ipamorelin acetate and kisspeptin-10, alongside the small molecule ibutamoren mesylate. A second table, headed "nominated but withdrawn," holds seventeen more, including AOD-9604, BPC-157, cathelicidin LL-37, CJC-1295, emideltide (DSIP), epitalon, GHK-Cu, KPV, PEG-MGF, melanotan II, MOTS-c, selank acetate, semax, thymosin alpha-1 and TB-500.

Sermorelin appears on neither table. Almost every compound it is commonly stacked with appears on one or the other. That contrast is the single most useful fact in this article.

WADA 2026: sermorelin is named explicitly at S2.2.4 — "growth hormone-releasing hormone (GHRH) and its analogues (e.g. CJC-1293, CJC-1295, sermorelin and tesamorelin)" — prohibited at all times, non-specified. Legal to prescribe is not legal to compete on. See our FDA peptide regulation timeline.

What is sermorelin, and how do you tell it from Mod GRF (1-29)?

Sermorelin is the unmodified first 29 amino acids of human growth hormone-releasing hormone — YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂, amidated, CAS 86168-78-7, formula C₁₄₉H₂₄₆N₄₄O₄₂S, molecular weight 3,357.9 g/mol. It agonises the GHRH receptor, stimulating the pituitary's own GH release. Its nearest market rival, Mod GRF (1-29), sits just 10 daltons away at 3,367.9 — but the Met27→Leu27 substitution that produces that gap removes the molecule's only sulfur atom.

The dual ATC coding is a historical artefact worth noticing: this compound was classified both as a hormone therapy and as a diagnostic agent, because it was approved as both.

Ten daltons is nothing to a purity certificate and everything to a mass spectrometer. Because the substitution also changes elemental composition — sulfur present versus sulfur absent — the two molecules are distinguishable on composition as well as mass. Both are trivial for mass spectrometry and impossible for HPLC purity alone.

Be aware that querying "CJC-1295" in chemical databases returns the DAC form at 3,647.2. A vendor selling "CJC-1295" at 3,367.9 is selling Mod GRF (1-29). See CJC-1295 without DAC.

What is sermorelin actually proven to do?

Sermorelin's strongest evidence is diagnostic, not therapeutic. Prakash and Goa's review (BioDrugs, 1999) concluded that intravenous sermorelin at 1 µg/kg "appear[s] to be a rapid and relatively specific test for the diagnosis of growth hormone deficiency." The GHRH-arginine test built on it became, in the Endocrine Society's 2011 guideline, one of two tests with "sufficient sensitivity and specificity to establish the diagnosis" of adult GH deficiency, at a cut-point of 4.1 µg/L.

Paediatric growth. Neyzi et al. (Acta Paediatrica, 1993) randomised 43 prepubertal children with hypothalamic GH deficiency to low-dose GHRH(1-29)NH₂, high-dose, or recombinant GH for six months. Height velocity rose by at least 2 cm/year in all but two children. But height standard-deviation-score for bone age improved only in the GH group. The authors concluded that GH and high-dose GHRH had "similar growth-promoting effects" on the shorter-term measure.

Prakash and Goa characterise the therapeutic evidence in their own words: "Limited data suggest that once daily subcutaneous sermorelin 30 µg/kg bodyweight is effective in promoting growth in some prepubertal children."

That is the basis of the 1997 approval, and it is consistent with a product discontinued nine years later.

FDA's own commissioned review reached the same place from the other direction. A December 2020 report prepared for FDA by the University of Maryland CERSI examined sermorelin's nomination for compounding and found two peer-reviewed studies meeting inclusion criteria — both 1996 diagnostic studies — zero survey responses, and no clinical practice guideline recommending sermorelin.

Does sermorelin do anything for older adults?

This is what sermorelin is actually sold for, and the single trial that asked found nothing downstream of the GH curve. Vittone et al. (Metabolism, 1997) gave 11 healthy men aged 64–76, selected for low baseline IGF-1, 2 mg subcutaneously nightly for six weeks. Nocturnal GH release rose (P<.02), as did GH peak area (P<.006) and amplitude (P<.05). IGF-1 did not change. Nor did IGFBP-3, GH-binding protein, weight, BMI, waist-to-hip ratio, or DEXA-measured muscle and fat.

Muscle histology, glucose, insulin and lipids were also unchanged. Two of six strength measures improved — upright row and shoulder press — plus abdominal crunch endurance.

The authors' own conclusion is the sentence that matters: "These data suggest that single nightly doses of GHRH are less effective than multiple daily doses of GHRH in eliciting GH- and/or IGF-I-mediated effects."

A citation trap worth naming. The favourable adult results usually attributed to sermorelin — rising IGF-1, increased lean body mass — come from Khorram et al. (JCEM, 1997), which studied [Nle27]GHRH(1-29)NH₂, a norleucine-27 analogue. Different molecule. That study did find IGF-1 and IGFBP-3 rises within two weeks and increased lean body mass in men. It is not a sermorelin study, and it is the most common substitution error in sermorelin content anywhere.

What the field's own experts say. Gerald Merriam, who ran some of the more favourable GHRH-in-ageing work, co-authors the Endotext chapter on growth hormone and aging, updated March 2026. It reports a six-month trial with a 35% IGF-1 rise, increased lean mass and reduced visceral fat, and then states: "no improvements in strength or aerobic fitness." It also notes that GHRH "failed to improve and may even have impaired slow wave (deep) sleep" — the opposite of what sermorelin sleep marketing claims. Its bottom line: "GH use for anti-aging purposes is not warranted and is currently prohibited by US federal law."

Claims versus evidence

Sermorelin's regulatory claims mostly hold and its clinical claims mostly do not. The approvals were real, the safety determination was real, and the absence from Category 2 is real. What fails is everything attached to adult use: no IGF-1 rise in the one adult trial, no DEXA body-composition change at six weeks, and a deep-sleep claim that the ageing literature actively contradicts. Ten claims, and the split runs almost exactly along the regulatory-versus-clinical line.

Is a compounded prescription different from a research vial?

Legally and materially, yes — and sermorelin is one of very few peptides where both routes genuinely exist, which makes the comparison concrete rather than theoretical. A compounded sermorelin prescription requires, by statute: a valid prescription for a named patient; a licensed pharmacist in a state-licensed pharmacy; API from an FDA-registered establishment; and a valid certificate of analysis for the bulk substance — a requirement on the raw material, distinct from a marketing certificate on a finished vial.

USP <795> and <797> govern sterility, beyond-use dating and documented stability. 503B outsourcing facilities are additionally subject to CGMP; 503A pharmacies are not.

FDA is still blunt about the limits of all of it: "Compounded drugs are not FDA-approved. This means that FDA does not verify the safety, effectiveness or quality of compounded drugs before they are marketed."

A gray-market research vial has none of that — and FDA has said so about sermorelin by name. A Warning Letter dated 10 December 2024 to Xcel Research LLC named seven products including sermorelin. Despite labelling reading "FOR RESEARCH USE ONLY" and "NOT INTENDED FOR HUMAN USE," FDA held the products were unapproved new drugs in violation of sections 505(a) and 301(d) of the Food, Drug and Cosmetic Act, because website evidence established human intended use.

The "research use only" disclaimer is not a legal shield, and FDA has demonstrated that with this compound specifically. See compounding pharmacy versus research peptide.

What does the platform data show, and how do you verify a vial?

The purity is unremarkable and the pricing is not. The Purity Index records sermorelin at 99.34 across 208 recency-weighted tests from 17 laboratories (verified August 2026), against a platform composite of 99.50. Sermorelin price data shows 45 shops in stock, median $7.00/mg and a lowest tracked price of $1.00/mg on a 10 mg vial (verified August 2026) — a 15× spread at nominally comparable purity. Those figures exclude shipping, taxes and customs, coupon codes, bulk tiers, multi-vial kits and account-gated pricing.

A $1.00/mg outlier deserves scepticism rather than enthusiasm, particularly given that the sermorelin compound page records one vendor's product measuring 12.88 mg against a 10 mg label — a 28.8% overage. Overfill is not generosity; it is evidence that fill accuracy is not controlled. Note also that endotoxin data is largely absent across sermorelin listings — most entries report nothing at all.

Peptigrity tracks 530 shops and 11,852 independent lab tests across 118 peptides, with 1,283 community reviews (verified August 2026), weighting community reviews and independently verified purity equally in every trust score.

See how to verify peptide quality before you buy, mass spectrometry for peptides, why 10 mg isn't 10 mg and where to buy sermorelin: 7 purity and identity checks.

How does sermorelin compare with tesamorelin, CJC-1295 and ipamorelin?

Sermorelin has the best regulatory record in the class and the weakest adult efficacy record. Tesamorelin is the instructive comparison — same pharmacological class, same axis, and an FDA approval that is live today, built on randomised trials with a hard imaging endpoint in a defined population. CJC-1295 without DAC has no human trial of the no-DAC form at all, and PCAC rejected all five of its substances. Ipamorelin has one failed Phase 2 and a 0–12 PCAC vote against it.

That is what adequate evidence for an adult indication looks like, and sermorelin does not have it. For the three-way version of this question, see ipamorelin vs sermorelin vs tesamorelin.

The trial that would settle this

One study would resolve the adult question that sermorelin's entire market rests on: a randomised, placebo-controlled trial of multiple daily doses in adults seeking body-composition change, with DEXA and function as the primary endpoints, running well beyond six weeks and comparing against tesamorelin. Every element of that design exists because the current evidence lacks it — the adult trial was open-label with 11 men, dosed once nightly, for six weeks, and its own authors said once-nightly was the weaker regimen.

Frequently Asked Questions

Was sermorelin really FDA-approved?

Yes, twice — Geref Diagnostic in December 1990 for pituitary function testing, and Geref in September 1997 for paediatric growth hormone deficiency. Both approvals were withdrawn effective June 2009 after the sponsor discontinued the products commercially. No generic was ever approved.

Was it withdrawn because it was unsafe?

No. FDA formally determined in 2013 that the products "were not withdrawn for reasons of safety or effectiveness," specifically to allow generic applications. None followed. The primary source is the Federal Register of 4 March 2013, at 78 FR 14095–14096.

Why can pharmacies compound sermorelin when other peptides are banned?

Because it qualifies as a component of a previously FDA-approved drug — one of the three statutory routes for a bulk substance in 503A compounding. It is also absent from FDA's significant-safety-risk list, unlike CJC-1295, ipamorelin, GHRP-2 and GHRP-6.

Does sermorelin work for anti-aging or body composition?

The one controlled trial in older adults found increased nocturnal GH but no change in IGF-1, body fat, lean mass, weight or BMI over six weeks. Favourable results often attributed to sermorelin come from a study of a different molecule, the norleucine-27 analogue.

Is compounded sermorelin the same as a research vial?

No. Compounded product requires a prescription, a licensed pharmacy, FDA-registered API, a statutory certificate of analysis and USP sterility standards. FDA named sermorelin in a December 2024 warning letter establishing that "research use only" labelling does not exempt a seller when the product is intended for human use.

Is sermorelin banned in sport?

Yes — named explicitly at WADA S2.2.4, prohibited at all times and classified as non-specified. The entry lists it alongside CJC-1293, CJC-1295 and tesamorelin as GHRH analogues.

Where sermorelin sits

Sermorelin is the most legitimate compound in its class and the one whose legitimacy is most misused. The approvals were real. The safety determination was real. The absence from FDA's Category 2 list is real, and it genuinely distinguishes sermorelin from everything it gets stacked with. Those three facts are the whole of sermorelin's advantage, and they are enough to make it the reasonable choice within this category.

None of them is evidence for what it is currently sold to do. A regulatory pedigree for diagnosing pituitary function and growing short children is not a pedigree for adult body recomposition — and the single trial that asked that question found nothing downstream of the GH curve.

The strongest argument against sermorelin is not that it is dangerous. It is that FDA's own commissioned review, looking for a reason to add it to the compounding list, could find two qualifying studies, both diagnostic, both from 1996, and no guideline recommending it for anything else.

Browse the growth hormone peptides category, or our complete peptide guide with 118 compounds (verified August 2026). For per-injection volume, use the peptide dosing calculator alongside the reconstitution calculator. Compare shops through independent lab tests and community-verified shop reviews.

This article is for educational and informational purposes only and does not constitute medical advice. Peptides discussed may be investigational compounds not approved by the FDA (or equivalent regulators in your jurisdiction) for human use. Always consult a qualified healthcare provider before using any peptide or research compound. Peptigrity is an independent review platform and does not sell, endorse, or recommend specific products or vendors.