Kisspeptin has a genuinely good human research programme, and none of it used the molecule you can buy. Every therapeutic trial administered kisspeptin-54. The market sells kisspeptin-10, a fragment with a half-life roughly six times shorter and no published human subcutaneous data.
That substitution is the whole story of this compound, and it separates kisspeptin from its neighbours in the libido and sexual wellness peptides category — where the usual problem is absent evidence rather than excellent evidence attached to the wrong molecule. It is also the distinction FDA itself drew when it listed kisspeptin-10 by name.
Is the kisspeptin you can buy the kisspeptin that was studied?
No. Every therapeutic kisspeptin trial from Imperial College London used kisspeptin-54, a 5,857.5 Da peptide with a plasma half-life of about 27.6 minutes. The market sells kisspeptin-10, a 1,302.5 Da fragment with a half-life of roughly four minutes — about six times shorter. No published study has ever administered kisspeptin-10 subcutaneously to a human being, which is the route the vials are sold for.
Waljit Dhillo's group at Imperial College London has run randomised, double-blind, placebo-controlled trials in men and women with hypoactive sexual desire disorder, triggered egg maturation in IVF without a single case of severe ovarian hyperstimulation, and restored gonadotropin release in hypothalamic amenorrhoea. The papers are in JCI, JAMA Network Open and JCEM. None of this is a criticism of that work.
It is a statement about what the work covers. The gap between the studied molecule and the sold molecule is not a technicality about fragment length — it is a six-fold difference in plasma half-life, a route with no published human data, and a form that FDA singled out by name for its list of bulk substances that may present significant safety risks.
What did the kisspeptin-54 trials actually show?
Real, replicated effects. Kisspeptin-54 modulated sexual and emotional brain processing in 29 healthy men (Comninos 2017), 32 premenopausal women with HSDD (2022) and 32 men with HSDD (2023), where penile tumescence increased by up to 56% over placebo. As an IVF trigger it produced 75–85% mature oocytes in 53 subfertile women and 95% oocyte maturation in 60 high-risk women, with no moderate, severe or critical OHSS.
Sexual and emotional brain processing. Comninos et al. 2017 (J Clin Invest, PMID 28112678): 29 healthy men, randomised double-blind two-way crossover, placebo-controlled. Kisspeptin-54, 1 nmol/kg/h, intravenous infusion over 75 minutes. Enhanced limbic activity to sexual and couple-bonding images; attenuated negative mood.
HSDD in women. JAMA Network Open 2022 (PMID 36287566): 32 premenopausal women with HSDD, randomised, double-masked, placebo-controlled crossover. Kisspeptin-54, 1 nmol/kg/h IV over 75 minutes. Significant modulation of brain activity to erotic stimuli; enhanced hippocampal responses correlating with improved sexual-function measures.
HSDD in men. JAMA Network Open 2023 (PMID 36735255): 32 men with HSDD, randomised, double-blind, placebo-controlled. Kisspeptin-54, intravenous infusion. Modulated sexual-processing brain activity; penile tumescence increased by up to 56% over placebo.
The IVF trigger is the most clinically striking result. Jayasena et al. 2014 (J Clin Invest, PMID 25036713): 53 subfertile women, single subcutaneous injection of kisspeptin-54 at 1.6–12.8 nmol/kg, 36 hours before egg retrieval. Mature oocyte proportion 75–85%; biochemical pregnancy 40%; clinical pregnancy 23%; ten live births. No severe OHSS. Abbara et al. 2015 (JCEM, PMID 26192876) extended this to 60 women at high OHSS risk: oocyte maturation in 95%, live birth 45–63% by dose, and "no woman developed moderate, severe, or critical OHSS."
Ovarian hyperstimulation syndrome is the major iatrogenic risk of IVF, and a trigger that avoids it matters. Note the delivery pattern in every one of those studies: intravenous infusion in a hospital, or a single subcutaneous trigger dose 36 hours before a scheduled procedure.
Can kisspeptin be used daily?
The evidence argues directly against it. Jayasena et al. 2009 put the finding in the title of a JCEM paper: subcutaneous kisspeptin-54 acutely stimulates gonadotropin secretion in women with hypothalamic amenorrhoea, but chronic administration causes tachyphylaxis. The 2010 follow-up quantified it across eight weeks and three regimens — twice-weekly dosing produced only partial desensitisation, in contrast to the complete tolerance achieved with twice-daily administration.
The full title of Jayasena et al. 2009 (JCEM, PMID 19820030) reads: "Subcutaneous Injection of Kisspeptin-54 Acutely Stimulates Gonadotropin Secretion in Women with Hypothalamic Amenorrhea, But Chronic Administration Causes Tachyphylaxis."
Jayasena et al. 2010 (Clin Pharmacol Ther, PMID 20980998) states the comparison directly: "Twice-weekly KP-54 resulted in only partial desensitization, in contrast to the complete tolerance achieved with twice-daily administration."
Complete tolerance on twice-daily dosing. Whatever kisspeptin does, doing it twice a day stops it working. Daily consumer protocols are running the arm of that study that failed, and they are doing it with a shorter-lived fragment by a route nobody has published. This is the finding nobody selling kisspeptin mentions.
What is the complete human record for kisspeptin-10?
Two published studies, both intravenous, both in hospital. George et al. 2011 gave an IV bolus of 0.01–3.0 µg/kg plus four-hour infusions, with maximal LH stimulation at 1 µg/kg. Jayasena et al. 2015 compared kisspeptin-10, kisspeptin-54 and GnRH head to head by three-hour infusion and produced the half-life figure. No published study has administered kisspeptin-10 subcutaneously, and zero registered trials involve intranasal administration.
George et al. 2011 (JCEM, PMID 21632807) recorded LH rising from 4.1 ± 0.4 to 12.4 ± 1.7 IU/L within 30 minutes (P<0.001) at the 1 µg/kg bolus. A four-hour infusion took LH from 5.4 ± 0.7 to 20.8 ± 4.9 IU/L, with testosterone rising.
Jayasena et al. 2015 (Hum Reprod, PMID 26089302) ran three-hour continuous IV infusions in healthy men and produced the number this article turns on: kisspeptin-10 is "∼6-fold shorter" than kisspeptin-54, approximately 4 minutes against 27.6.
ClinicalTrials.gov returns 45 records mentioning kisspeptin, 32 interventional. Seven mention subcutaneous administration — and the ones using kisspeptin as an intervention used kisspeptin-54, or delivered it pulsatilely over two weeks (NCT05633966, Massachusetts General Hospital, completed August 2025, n=13 women with hypothalamic amenorrhoea). Zero involve intranasal administration.
How does a market vial compare with the dose that worked?
Kisspeptin is sold in 5 mg and 10 mg vials. The intravenous bolus that produced maximal LH stimulation in George et al. 2011 was 1 µg/kg — about 0.07 mg for a 70 kg adult. A single market vial is therefore roughly 70 to 140 times that dose, of a molecule with a six-times-shorter half-life than the one used in the therapeutic trials, by a route nobody has published.
Working from the verified trial parameters, for a 70 kg adult:
Regimen | Total kisspeptin |
|---|---|
Brain/HSDD infusion: KP-54 at 1 nmol/kg/h × 1.25 h | ~0.51 mg per session, IV, in hospital |
IVF trigger: KP-54 at 6.4 nmol/kg | ~2.6 mg, single subcutaneous dose |
IVF trigger: KP-54 at 12.8 nmol/kg | ~5.25 mg, single subcutaneous dose |
George 2011 max-effect KP-10 IV bolus at 1 µg/kg | 0.07 mg |
That is not a fine-tuning problem. It is a different experiment. For converting a vial into a per-injection volume, the peptide dosing calculator and the reconstitution calculator will do the arithmetic — but no calculator can supply a dose that no study has established.
How do kisspeptin-10 and kisspeptin-54 differ?
By 4,555 daltons and a factor of about six in half-life. Both are cleaved from the same 138-amino-acid KISS1 precursor and both activate KISS1R, but kisspeptin-54 spans precursor residues 68–121 at 5,857.5 Da, while kisspeptin-10 is residues 112–121 at 1,302.5 Da. Both are C-terminally amidated at Phe121, and that amide is required for receptor activity. A four-minute half-life and a twenty-eight-minute half-life do not describe the same pharmacokinetic profile.
Form | Precursor residues | Sequence |
|---|---|---|
Kisspeptin-54 (metastin) | 68–121 | GTSLSPPPESSGSPQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH₂ |
Kisspeptin-14 | 108–121 | DLPNYNWNSFGLRF-NH₂ |
Kisspeptin-13 | 109–121 | LPNYNWNSFGLRF-NH₂ |
Kisspeptin-10 | 112–121 | YNWNSFGLRF-NH₂ |
Kisspeptin-10 | Kisspeptin-54 | |
|---|---|---|
PubChem CID | 25240297 | 71306396 |
CAS | 374675-21-5 | 374683-24-6 |
Formula | C₆₃H₈₃N₁₇O₁₄ | C₂₅₈H₄₀₁N₇₉O₇₈ |
MW | 1,302.5 | 5,857.5 |
Plasma half-life | ~4 minutes | ~27.6 minutes |
Human subcutaneous data | None published | Five published trials |
A sourcing warning. At least one commercial supplier publishes a kisspeptin-54 sequence with arginine at position 14 where UniProt has proline, plus a garbled single-letter string. Verify sequences against UniProt Q15726, not vendor pages. See red flags in peptide certificates of analysis.
Where does kisspeptin stand with FDA and WADA?
Kisspeptin-10 is on FDA's active Category 2 list of bulk substances that may present significant safety risks — one of only five peptides that remain there, alongside GHRP-2, GHRP-6, ibutamoren and ipamorelin acetate. WADA's 2026 Prohibited List names "Kisspeptin and its agonist analogues" explicitly under section S2.2.1, testosterone-stimulating peptides in males, prohibited at all times. The listed FDA entity is kisspeptin-10 specifically, not kisspeptin generically.
Most peptides discussed on this site have been moved off that list into a "nominated but withdrawn" table. Kisspeptin-10 has not. FDA's stated reason, verbatim from the page current 22 April 2026:
"Compounded drugs containing Kisspeptin-10 may pose risk for immunogenicity for certain routes of administration and may have complexities with regard to peptide-related impurities and API characterization."
Category 2 means, in FDA's words, that a substance was "nominated with sufficient supporting information to permit FDA to evaluate" it and "may be eligible for inclusion on the 503A bulks list," but that FDA "has identified significant safety risks relating to the use of these substances in compounding pending further evaluation." It is not legally compoundable while it sits there.
WADA requires no interpretation here. Section S2.2.1 of the 2026 Prohibited List is headed "Testosterone-stimulating peptides in males including, but not limited to:" and names, alongside chorionic gonadotrophin, luteinizing hormone and GnRH, "Kisspeptin and its agonist analogues." Named by name, prohibited at all times, with the prohibition restricted to males by the subsection heading. See are peptides legal for jurisdictional detail.
Which kisspeptin claims survive the evidence?
Two of ten, and both are about kisspeptin-54. Kisspeptin-54 has strong human trial data, and it is established as an IVF trigger achieving 95% oocyte maturation with no moderate, severe or critical OHSS. Everything else is qualified or false: the trials do not support the product sold, kisspeptin-10 has never been given subcutaneously, daily use is contradicted by complete tachyphylaxis, and both FDA and WADA claims fail.
Claim | Evidence | Verdict |
|---|---|---|
Kisspeptin has strong human trial data | Multiple RCTs from Imperial College London | True — for kisspeptin-54 |
Those trials support the product sold | All therapeutic trials used KP-54, IV or single SC dose | No |
Kisspeptin-10 has been given to humans | Twice, both IV, in acute physiology studies | IV only |
Kisspeptin-10 has been given subcutaneously | No published study | Never |
Improves sexual desire | Real effects on brain processing and tumescence — with KP-54 by IV infusion | Route- and form-specific |
Works as an IVF trigger without OHSS | Two trials, 95% maturation, no moderate/severe/critical OHSS | Established for KP-54 |
Safe for daily use | Twice-daily KP-54 produced complete tachyphylaxis | Contradicted |
Raises testosterone | KP-10 IV infusion raised LH and testosterone acutely | Acutely, by IV |
Not on FDA's risk list | Kisspeptin-10 IS on active Category 2 | False |
Not banned in sport | WADA S2.2.1, named explicitly, males | False |
How does kisspeptin compare with gonadorelin and hCG?
Every compound in this group has real human evidence for a specific delivery pattern, and is sold for a different one. Kisspeptin's evidence is intravenous infusion or a single subcutaneous trigger dose; gonadorelin's is a pump delivering pulses every 90 minutes; hCG has randomised evidence for maintaining intratesticular testosterone on TRT. All four are named in WADA section S2.2.1 and prohibited at all times.
Compound | Human evidence | Regulatory | WADA |
|---|---|---|---|
Kisspeptin-54 | Multiple RCTs, IV infusion or single SC dose | Unapproved | S2.2.1, named |
Kisspeptin-10 (what is sold) | Two IV studies; no SC data | Active FDA Category 2 | S2.2.1, named |
Pulsatile pump only; no evidence for weekly SC | USP monograph → compoundable | S2.2.1, named | |
hCG | Randomised evidence for maintaining intratesticular testosterone on TRT | Prescription drug | S2.2.1, named |
The market sells kisspeptin and gonadorelin as periodic self-administered injections, which is the regimen nobody studied — and in kisspeptin's case, the regimen closest to it produced complete tolerance. See kisspeptin versus gonadorelin versus hCG for the head-to-head.
The contrast with the melanocortin side of this category is instructive. PT-141 has an FDA approval and trial data that did not move the behavioural endpoint; kisspeptin has trial data that moved several endpoints convincingly, in a molecule and by a route the market does not supply. Neither situation is the ordinary one of missing evidence.
What does the platform data show for kisspeptin?
The Purity Index records kisspeptin at 99.42% average across 148 independent HPLC tests from Freedom Diagnostics, Ethos Analytics, ILS, MZ Biolabs and Bioviridian, across 223 verified shops (verified August 2026). Two anomalies stand out: one vendor returned tests at 97.83% and 97.28% on 29 June 2026, and another an 11.41 mg fill on a 10 mg label, +14.1%. Price data shows 36 shops in stock at a $5.00/mg median.
Those two results, at 97.83% and 97.28%, came from the same vendor on 29 June 2026 — well below the platform norm and, on a peptide sold for injection, worth avoiding.
Kisspeptin price data shows the lowest listing at $3.00/mg on a 10 mg vial and the highest at $13.80/mg on a 5 mg vial (verified 10 August 2026). Those figures exclude shipping, taxes and customs, coupon codes, bulk tiers, multi-vial kits and account-gated pricing. Those 148 tests sit inside a platform total of 11,852 independent lab tests across 118 peptides and 530 shops, with 1,283 community reviews (verified August 2026).
Which form is in the vial, and how would you know?
Mass spectrometry, and nothing else. Kisspeptin-10 at 1,302.5 Da and kisspeptin-54 at 5,857.5 Da differ by 4,555 Da — an enormous, trivially detectable gap that MS separates instantly. A purity percentage alone does not record which molecule was tested, and the platform's listings are dominated by kisspeptin-10 while the clinical literature is dominated by kisspeptin-54. Establish which one is in the vial before anything else.
That is the reverse of the analytical problem on the melanocortin side of this category, where PT-141 and melanotan II sit about one dalton apart and high-resolution instruments are needed to separate them. Here the separation is trivial. The gap is not that the test is hard; it is that a purity percentage does not report the answer.
Check | What it confirms | How | Red flag |
|---|---|---|---|
Mass spectrometry | Which form — 1,302.5 Da (KP-10) vs 5,857.5 Da (KP-54) | Batch-matched CoA with MS | HPLC percentage with no MS |
C-terminal amidation | The Phe121 amide required for activity | MS mass matching the amide, not the free acid | Not addressed |
Net peptide content | Peptide versus salt and water | Net content or amino acid analysis | Purity quoted as quantity |
Fill accuracy | Vial matches label | Quantitative content testing | +14% overages |
Endotoxin (LAL) | No pyrogens — FDA's stated concern for this substance | LAL result on the batch | Field blank |
Compare vendors on the kisspeptin compound page, and see mass spectrometry for peptides for what a batch-matched identity result should look like.
The trial that would settle this
The trial that would settle kisspeptin has to use kisspeptin-10 specifically, subcutaneously, because every therapeutic trial used kisspeptin-54 and no published human subcutaneous data for kisspeptin-10 exists. Pharmacokinetics come first: whether a four-minute half-life survives subcutaneous absorption is the question the entire premise rests on. It would then run randomised and placebo-controlled for at least eight weeks with a desensitisation endpoint, with doses grounded in the 0.07 mg intravenous effective bolus.
Element | Requirement | Why |
|---|---|---|
Molecule | Kisspeptin-10 specifically | Every therapeutic trial used KP-54 |
Route | Subcutaneous | No published human SC data for KP-10 exists |
Pharmacokinetics first | Does a 4-minute half-life survive SC absorption? | The entire premise depends on this |
Design | Randomised, placebo-controlled | The KP-10 studies were acute physiology, not efficacy |
Duration | 8 weeks minimum, with a desensitisation endpoint | Twice-daily KP-54 produced complete tachyphylaxis by 8 weeks |
Dose | Grounded in the 0.07 mg IV effective bolus | Market vials are 70–140× that |
The pharmacokinetics row decides everything. A four-minute plasma half-life given subcutaneously — where absorption is slow and sustained — may produce exactly the continuous receptor exposure that the 2010 study showed causes complete tolerance. That is a testable question and nobody has tested it.
Frequently Asked Questions
Does kisspeptin work?
Kisspeptin-54 has real, replicated effects in randomised placebo-controlled trials: it modulates sexual brain processing in men and women with HSDD, increased penile tumescence by up to 56% over placebo, and works as an IVF trigger achieving 95% oocyte maturation with no moderate or severe ovarian hyperstimulation. All of that used intravenous infusion or a single subcutaneous trigger dose in a clinical setting.
Is kisspeptin-54 the same as what I can buy?
No. The market sells kisspeptin-10, a shorter fragment with a plasma half-life around four minutes against kisspeptin-54's twenty-eight. Kisspeptin-10 has been given to humans only intravenously, in two acute physiology studies. No published study has administered it subcutaneously.
Can I use kisspeptin daily?
The evidence argues against it. Twice-daily subcutaneous kisspeptin-54 over eight weeks produced complete tachyphylaxis — the response disappeared. Twice-weekly dosing produced only partial desensitisation. Daily protocols run the regimen that stopped working.
Is kisspeptin on FDA's risk list?
Kisspeptin-10 is on the active Category 2 list — one of only five peptides that remain there. FDA's stated concern is immunogenicity risk for certain routes and complexity around peptide-related impurities and API characterisation.
Is kisspeptin banned in sport?
Yes, explicitly. WADA's 2026 Prohibited List section S2.2.1 names "kisspeptin and its agonist analogues" among testosterone-stimulating peptides in males. Prohibited at all times.
How do I know which form of kisspeptin I have?
Mass spectrometry. Kisspeptin-10 is 1,302.5 Da; kisspeptin-54 is 5,857.5 Da. That is a 4,555 Da difference — impossible to miss with MS and impossible to determine from an HPLC purity percentage alone.
Where kisspeptin sits
Kisspeptin is the clearest case on this platform of good science being used to sell a different molecule. The Imperial College programme is legitimate randomised, placebo-controlled work published in JCI, JAMA Network Open and JCEM, with an IVF result — 95% oocyte maturation without moderate, severe or critical ovarian hyperstimulation — that could change clinical practice. None of it studied subcutaneous kisspeptin-10 from a 10 mg vial.
The differences compound rather than cancel. A different molecule, a six-times-shorter half-life, a route with no published human data, at 70 to 140 times the effective intravenous bolus dose — and against a published finding that the closest studied regimen, twice-daily dosing of the longer-lived form, produced complete tolerance within eight weeks.
FDA has been unusually precise here. It did not list "kisspeptin." It listed kisspeptin-10. The regulator drew exactly the distinction the marketing does not.
Browse the libido and sexual wellness peptides category, or our complete peptide guide with 118 compounds (verified August 2026). For per-injection volume, use the peptide dosing calculator alongside the reconstitution calculator. Compare shops through independent lab tests and community-verified shop reviews.
This article is for educational and informational purposes only and does not constitute medical advice. Peptides discussed may be investigational compounds not approved by the FDA (or equivalent regulators in your jurisdiction) for human use. Always consult a qualified healthcare provider before using any peptide or research compound. Peptigrity is an independent review platform and does not sell, endorse, or recommend specific products or vendors.
