PNC-27: Zero Human Trials, and Two Independent Studies That Disagree About Why It Works

ClinicalTrials.gov returns totalCount = 0 for PNC-27. In the twenty-two years since the first paper, no phase 1, no safety study, no human dose, no route, no toxicity profile and no pharmacokinetics — nowhere in the world.

If you or someone close to you has cancer and has arrived at this page, that is the fact that matters most, and everything below is detail. Evidence-based oncology through a licensed physician is what is available. An unapproved research peptide with no human data is not an alternative to it, and taking it can compromise treatments that do have evidence behind them.

What follows is our best reading of what the research actually shows, because you deserve an accurate account rather than either hype or dismissal. We checked the registry twice, through two different query forms, against an endpoint that returns 597,691 studies when queried with nothing — so the zero is real, not a broken search. Vendor listings and identity details sit on the PNC-27 compound page, within the immune support and longevity peptides category.

What has PNC-27 actually been tested in?

PNC-27 has been tested in cell culture, in ex vivo patient-derived ovarian tumour tissue and in a small number of mouse models — never in a human. PubMed returns 25 records for PNC-27, and none is a clinical trial. The published work runs from a 2004 Biochemistry NMR structure to a 2024 membrane study, with much of the output concentrated in two journals, Annals of Clinical and Laboratory Science and Anticancer Research.

The models matter. In vivo work exists but is limited — a PubMed search for PNC-27 with mice returns six records, and the highest-profile paper, the 2010 PNAS study, is not among them.

Cell culture results do not predict human outcomes. Most compounds that kill cancer cells in a dish fail in animals, and most that work in animals fail in people. That is the ordinary attrition of oncology drug development, not a criticism of this particular molecule.

A search-hygiene warning for anyone checking these citations. The raw PubMed query for "PNC-27" returns 25 hits including at least two false positives — PMID 30404661, a study of child mortality and maternal healthcare in Nigeria (matching "PNC" as postnatal care), and PMID 15994461, an analysis of out-of-hospital coronary deaths and air pollution in Rome. Do not cite a PNC-27 PMID without opening it.

Did an independent group confirm PNC-27 works in animals?

Yes. Wang, Zhao, Nguyen and colleagues at Zhejiang University and the City of Hope Medical Center — none of the originating group among the 22 authors — reported in Leukemia 2020;34(1):75–86 that PNC-27 selectively killed acute myeloid leukaemia blasts and leukaemic stem cells in both human and murine AML models, demonstrated in primary and secondary transplant experiments, while sparing normal haematopoietic stem cell activity. That is genuine independent preclinical corroboration in a top-tier haematology journal, and it is not the whole story.

Their finding, verbatim, in "Targeting cell membrane HDM2: A novel therapeutic approach for acute myeloid leukemia" (PMID 31337857):

"PNC-27 treatment in vivo resulted in a significant killing of both AML 'bulk' blasts and LSCs, as demonstrated respectively in primary and secondary transplant experiments, using both human and murine AML models."

And: "PNC-27 spares normal HSC activity."

But their proposed mechanism is not pore formation. Their account is that "PNC-27 binds to mHDM2 and enhances the interaction of mHDM2 and E-cadherin on the cell membrane; in turn, E-cadherin ubiquitination and degradation lead to membrane damage and cell death of AML blasts by necrobiosis."

So the strongest independent result in the PNC-27 file replicates the effect and rejects the explanation. That combination is unusual, and it is the part of the literature that almost never appears in marketing.

Does PNC-27 kill only cancer cells?

No. An independent measurement from West China Hospital, Sichuan University, published in the Journal of Biological Chemistry in 2010, found that "the IC50 values of PNC27 in tumor cells were 2-3 times lower than in normal cells." Two- to three-fold selectivity means PNC-27 is more toxic to tumour cells than to normal cells — not that it spares normal cells. That is a meaningful difference from how the compound is usually described.

The same paper, Yang, Liu, Cai et al. (PMID 20484051), went further, using an experimental design built specifically to isolate where the selectivity comes from. When the authors swapped the penetratin leader for TAT, R9 or DPV3, the selectivity vanished. When they attached penetratin to entirely unrelated mitochondria-disrupting peptides, the selectivity reappeared.

Their conclusion: "the leader peptide Antp contributes to the preferential cytotoxicity of Antp-directed peptides," mediated by chondroitin sulfate overexpression on tumour cells.

If that is right, PNC-27's tumour selectivity tracks the cell-penetrating delivery leader, not the p53/HDM-2 domain that gives the compound its name and its entire rationale.

Why do three published mechanisms compete?

Because three groups reached three different answers, and none has been independently confirmed. The originating group proposes membrane pore formation after binding HDM-2; Leukemia 2020 proposes E-cadherin ubiquitination and degradation leading to necrobiosis; JBC 2010 proposes chondroitin-sulfate-mediated uptake driven by the penetratin leader. We found no paper reporting a failure to replicate, and equally no independent confirmation of the pore-formation mechanism the compound is named and marketed for.

Competing mechanisms are normal in early-stage pharmacology and are not evidence of bad science. What makes this case consequential is that the three accounts imply different things about who a treatment could help. If the mechanism runs through membrane HDM-2, the relevant patients are those whose tumours express it. If it runs through chondroitin sulfate on the cell surface, the p53 fragment may be close to incidental and the compound's identity as a "p53 tumour-lytic peptide" is mostly branding.

Nobody can currently say which is correct, and no human study has ever been run that could adjudicate it.

What is PNC-27, and what is it made of?

PNC-27 is a 32-residue chimeric peptide, PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG, fusing p53 residues 12–26 — the HDM-2 binding region — to a penetratin-derived cell-penetrating leader. Its molecular weight is approximately 4,031.8 Da, which is our calculation from the published sequence, computed two independent ways, not a registry value. No CAS number exists that we could locate through PubChem, NCBI or any other source, so there is no registry entry to check a certificate of analysis against.

The originating group's own published description is "a 32-residue peptide that contains an HDM-2 binding domain and a cell-penetrating peptide (CPP) leader sequence." The two-part construction is exactly what the JBC leader-swap experiment exploited: because the molecule is a fusion, its components can be separated and tested against each other, which is how the delivery tag came under suspicion in the first place.

Which PNC-27 claims survive the evidence?

PNC-27's cell-culture cancer killing is true and independently corroborated, and its animal activity is supported preclinically by the Leukemia 2020 work. Everything human is absent: no trial, no safe dose, no pharmacokinetics. Three claims are worse than absent — "kills only cancer cells" is overstated against 2–3 fold selectivity, the pore-formation mechanism is contested by two competing accounts, and the claim that the p53 domain drives selectivity is challenged by the leader-swap experiment.

Is PNC-27 legal, and has FDA acted on it?

PNC-27 is an unapproved new drug in the United States and cannot be legally compounded: it has no USP monograph, is not a component of any FDA-approved drug, and does not appear on FDA's 503A bulks list, so it satisfies none of the three statutory routes. On enforcement we have to state a limit plainly — we can tell you neither that FDA has warned about PNC-27, nor that it has not. We could locate no action naming it.

It does not appear anywhere on FDA's bulk substances compounding page (current 22 April 2026).

The reason for the enforcement hedge is methodological. We attempted to search FDA's warning letter database and FTC's enforcement database for PNC-27. FDA's search returned an anti-bot challenge page and its warning-letter table renders results via JavaScript that our tooling could not read; FTC's search is blocked to automated access. The absence of a warning letter is not an endorsement, and its presence would not be news — the compound is plainly an unapproved drug being sold.

On WADA, PNC-27 is not named on the 2026 Prohibited List. The S0 catch-all prohibits "any pharmacological substance... with no current approval by any governmental regulatory health authority for human therapeutic use," explicitly including "drugs under pre-clinical or clinical development." PNC-27 is the clearest S0 candidate on this platform. WADA chose to name BPC-157 — a comparable research peptide — in S0's illustrative list, which shows the agency names substances when it wants the point made.

What do 14 lab tests show about PNC-27?

They show high average purity on a very thin dataset with poor quantity control. The Purity Index records PNC-27 at 99.56% average across 14 independent tests (verified May 2026), from Liquilabs, Freedom Diagnostics, Ethos Analytics, Janoshik and others. Within those tests, one vendor's product came in +36% over label (June 2026) and another −14.6% under label (January 2026) — a fifty-point spread in fill accuracy on a 32-residue peptide.

Fourteen tests is among the thinnest datasets on this platform. A fifty-point spread between vendors is a manufacturing control problem, not a rounding artefact, and it means the milligram figure on a label carries little information here.

There is also a verification problem specific to this compound. PNC-27 has no CAS number and no chemical registry entry, and the molecular weight of approximately 4,032 Da is calculated from the published sequence rather than taken from an authoritative reference. A mass spectrometry result can therefore be checked against arithmetic, but not against a registry standard — and a 32-residue peptide synthesis has 31 coupling steps, each an opportunity for a deletion sequence that would shift the mass and might still show a clean HPLC peak.

PNC-27 price data shows 11 shops in stock, median $11.90/mg, lowest $4.83/mg on a 30 mg vial, with vial prices from $29.99 to $279.97 (verified 10 August 2026). Those figures exclude shipping, taxes and customs, coupon codes, bulk tiers, multi-vial kits and account-gated pricing. Peptigrity tracks 530 shops and 11,852 independent lab tests across 118 peptides, with 1,283 community reviews (verified August 2026), weighting community reviews and independently verified purity equally, at 50% each, in every trust score.

Our own compound page states the position accurately, and we are leaving it as written: "PNC-27 is a preclinical research compound with no published human clinical trials demonstrating cancer efficacy or safety," and "anyone with active cancer should pursue evidence-based treatment through licensed oncology care, not unproven research peptides."

How does PNC-27 compare with the other zero-trial peptides?

PNC-27 and FOXO4-DRI are the two compounds on this platform with zero human trials and a genuinely interesting preclinical story; MOTS-c has one recruiting trial and SS-31 has four or more phase 2/3 studies and a narrow FDA approval in 2025. What separates PNC-27 is what is at stake in acting on it. Someone taking FOXO4-DRI for longevity is spending money on an unknown; someone taking PNC-27 instead of oncology care has a much shorter clock.

PNC-27 is also the only compound in that group where the independent replication and the originating group disagree about the mechanism. For the other three, the argument is about how much the evidence shows, not about what the evidence means.

The trial that would settle this

The trial that would settle PNC-27 is a phase 1 dose escalation with safety and pharmacokinetics, because nothing exists and that is step one. It would have to establish a human route and dose, resolve which of the three published mechanisms is right — that determines which patients could benefit — and measure selectivity in humans against the 2–3 fold in vitro figure rather than the "cancer only" claim. It would also need sequence-confirmed investigational material, since no reference standard exists.

The last row is the honest obstacle. This compound has had a persistent research group behind it since 2004, and in 2020 one independent group confirmed the effect in mice in a major journal. That is more than most preclinical anticancer peptides achieve, and still nobody has taken it into a phase 1. Whatever the reason — funding, patents, toxicology, priorities — the practical result is that no human has been given this compound under observation and had the outcome published.

Frequently Asked Questions

Has PNC-27 been tested in people?

No. ClinicalTrials.gov returns zero registered studies of PNC-27, verified through two independent query forms. There is no phase 1, no safety study, no established human dose or route, and no published pharmacokinetic data.

Does it kill cancer cells?

In cell culture, yes, and this has been shown by several groups. An independent group at Zhejiang University and City of Hope also reported selective killing of acute myeloid leukaemia blasts in mouse models (Leukemia, 2020). Cell culture and mouse results do not establish that a compound works in people; most oncology candidates that pass those stages fail later.

Does it only kill cancer cells?

An independent measurement puts the selectivity at two to three fold — meaning it is more toxic to tumour cells than normal cells, not that it spares normal cells. That is a meaningful difference from how the compound is usually described.

How does it work?

There are three competing published answers: membrane pore formation after binding HDM-2 (the originating group), E-cadherin degradation causing necrobiosis (Leukemia 2020), and uptake driven by the penetratin delivery leader via chondroitin sulfate on tumour cells (JBC 2010). The third study found that swapping the leader abolished selectivity, and attaching the leader to unrelated peptides restored it — evidence that the selectivity may not come from the p53 domain at all.

Has FDA warned about it?

We could locate no FDA or FTC action naming PNC-27, but FDA's warning-letter search and FTC's search are not accessible to automated queries, so we cannot state that none exists. What is certain is that PNC-27 is an unapproved new drug, does not appear on any FDA compounding list, and cannot be legally compounded.

I have cancer. What should I do with this information?

Talk to your oncologist, including about anything you are considering taking. PNC-27 has never been given to a human being under observation with the result published — there is no dose, no known toxicity, and no way to predict how it interacts with chemotherapy, radiotherapy or immunotherapy. Unproven compounds can interfere with treatments that do have evidence behind them, and time spent on them is time not spent on those treatments.

What this means if you or someone you love has cancer

PNC-27 has never been given to a patient under observation with the outcome published — no dose, no known toxicity, no way to predict how it interacts with chemotherapy, radiotherapy or immunotherapy. Talk to your oncologist about anything you are considering taking. Unproven compounds can interfere with treatments that do have evidence behind them, and time spent on them is time not spent on those treatments.

PNC-27 is a serious preclinical research programme and an unproven product, and it is important to hold both of those at once. The science is not a fabrication. A group has worked on this molecule for over twenty years and published structural, cellular and some in vivo work in real journals, including PNAS. In 2020 an entirely independent group in a top haematology journal reported that PNC-27 selectively kills leukaemia cells in mouse models while sparing normal haematopoietic stem cells. That is a genuine and non-trivial finding.

The same body of literature contains two things the marketing leaves out. The independent group that replicated the effect rejected the mechanism the compound is named for. And a second independent group measured the selectivity at two to three fold and showed, by swapping components, that it tracks the delivery tag rather than the p53 fragment.

Above all: in twenty-two years, not one registered clinical trial. No dose. No safety data. No pharmacokinetics. Nothing that would tell a person what happens when they inject it.

If you are here because someone you love is ill, the most useful thing this article can tell you is that this compound has never been given to a patient under observation, and that the people best placed to help are the ones who can prescribe treatments that have been.

Browse the immune support and longevity peptides category, or our complete peptide guide with 118 compounds (verified August 2026). Compare shops through independent lab tests and community-verified shop reviews.

This article is for educational and informational purposes only and does not constitute medical advice. Peptides discussed may be investigational compounds not approved by the FDA (or equivalent regulators in your jurisdiction) for human use. Always consult a qualified healthcare provider before using any peptide or research compound. Peptigrity is an independent review platform and does not sell, endorse, or recommend specific products or vendors.