§ EDITORIAL · INDEPENDENT RESEARCH13 MIN READ · PUBLISHED FEB 14, 2026
Home Blog IGF-1 DES: The Emptiest Evidence File of Any Compound We Track
Muscle Growth & Recovery

IGF-1 DES: The Emptiest Evidence File of Any Compound We Track

P
Saturday, February 14, 2026 · 13 min read

IGF-1 DES has the thinnest evidence base and the thinnest market data of any compound on this platform: three independent lab tests, one shop in stock at $45.00 per milligram, and zero registered human studies.

It is a real molecule with a well-defined structure, and that is close to the end of what can be verified about it. This article sets out what is known, what is merely repeated, and what cannot be checked at all, inside the growth hormone peptides category and alongside its better-covered sibling IGF-1 LR3.

How much evidence exists for IGF-1 DES?

Almost none. Three independent lab tests exist for IGF-1 DES, from two laboratories; one shop currently has it in stock at $45.00 per milligram; and ClinicalTrials.gov returns zero registered studies. There is no published human pharmacokinetic data, no dose-ranging study, and no safety data of any kind for this specific molecule. It is nonetheless prohibited in sport — WADA section S2.3 names IGF-1 and its analogues, and DES(1-3)IGF-1 appears by name in published doping-control detection methods.

Those five facts are the whole file. Everything that follows either describes the structure, which is verifiable, or describes the class through the one approved IGF-1 product, which is not the same molecule.

Is IGF-1 DES shorter-acting than IGF-1 LR3?

No study supports that framing. IGF-1 DES and IGF-1 LR3 are marketed as complementary — DES as the shorter-acting, more locally active option, LR3 as the long-acting one — and no comparative human study of any kind supports the division. Neither compound has a published human pharmacokinetic profile against which "shorter" or "longer" could be measured, and both return zero registered studies on ClinicalTrials.gov. The claim is a marketing convention, not a finding.

Compound

Structure

Human trials

Platform tests

Mecasermin (Increlex)

Native IGF-1, 70 aa, 7,649 Da

Approved 2005

IGF-1 LR3

Extension + position-3 substitution

Zero

125

IGF-1 DES

Deletion of residues 1–3

Zero

3

PEG-MGF

PEGylated IGF-1Ec E-domain

Zero — FDA found no human exposure data

27

The two analogues do reach the same design goal by opposite structural routes: LR3 adds an N-terminal extension and substitutes position 3, while DES deletes the first three residues entirely. That is a real structural difference. It is not, on any published evidence, a measured difference in duration of action.

What is IGF-1 DES, structurally?

IGF-1 DES is DES(1-3)IGF-1 — native human IGF-1 with the first three residues, Gly-Pro-Glu, deleted. Native IGF-1 is a 70-residue chain with three disulfide bridges and a molecular weight of 7,649 Da, FDA's own figure from the mecasermin label; removing the N-terminal tripeptide leaves 67 residues beginning TLCGAELVDALQ. The rationale is the same as for IGF-1 LR3 — reduce binding to IGF binding proteins so more of the molecule stays free.

The mature parent sequence, from UniProt P05019, begins Gly-Pro-Glu:

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Attribute

Native IGF-1 (mecasermin)

IGF-1 DES

Residues

70

67

N-terminus

GPE... (Gly-Pro-Glu)

TLC... — first three deleted

Disulfide bridges

Three, intramolecular

Three, intramolecular

Molecular weight

7,649 Da (FDA's figure)

Computable, not sourced

Approval status

BLA 021839, approved 2005

None anywhere

We could not verify the reduced-IGFBP-affinity claim for DES from any primary source. It appears on our own compound page and across vendor listings. It is mechanistically plausible — the N-terminal tripeptide is in the region implicated in binding-protein interaction — but plausible is not the same as sourced, and we are flagging it rather than repeating it as fact. That claim is the compound's entire rationale, which makes its absence from the primary literature the most significant gap in this file.

Why does this article not print a molecular weight?

Because we could not verify one. The molecular weight of DES(1-3)IGF-1 can be computed from its 67-residue sequence, and we did compute it, but we could not verify that figure against any authoritative registry or regulatory source. A computed number presented as a specification is exactly the kind of claim this platform exists to catch. If a certificate of analysis quotes a DES mass, ask where the reference came from.

The distinction is not pedantry. A computed mass tells you what the molecule would weigh if it were exactly what the sequence says; it tells you nothing about whether an authoritative body has ever characterised the commercial material. Vendors quote such numbers as specifications, and a specification is supposed to be something a batch can fail against. See red flags in peptide certificates of analysis for the wider pattern.

Can a certificate of analysis confirm you have IGF-1 DES?

No certificate available in this market can confirm it. A 67-residue chain with three disulfide bridges is a protein rather than a peptide in the practical sense, and mass alone cannot confirm folding: a misfolded molecule has exactly the same mass as a correctly folded one and is biologically inactive. The deletion of Gly-Pro-Glu is a large, easily visible mass change — but without an authoritative expected mass, an MS reading is a number, not a confirmation.

Mass alone cannot confirm folding. IGF-1 and its analogues depend on three intramolecular disulfide bridges forming in the correct pairing. No mass spectrometry result distinguishes correct from incorrect pairing, because the atoms are identical either way.

The mass difference from native IGF-1 is large and detectable — if you have a reference. Removing Gly-Pro-Glu is a substantial deletion, easily visible on a mass spectrum against a known target. Without an authoritative expected mass for DES, that advantage is unavailable.

HPLC purity is close to useless as an identity test here. A homogeneous sample of misfolded or truncated protein returns a clean chromatogram at high purity. See mass spectrometry for peptides and what HPLC testing can and cannot tell you.

What is known about IGF-1 in humans?

Nothing about IGF-1 DES specifically; everything known about the class comes from one approved product. Mecasermin (INCRELEX), BLA 021839, approved 30 August 2005, is recombinant human IGF-1 for growth failure in children with severe primary IGF-1 deficiency, with a terminal half-life of 5.8 hours after a single 0.12 mg/kg subcutaneous dose. Its label reports hypoglycaemia in 42% of subjects, five severe episodes and four seizures or losses of consciousness.

The full indication is "growth failure in pediatric patients 2 years of age and older with severe primary IGF-1 deficiency or with growth hormone gene deletion who have developed neutralizing antibodies to GH."

Increlex does not carry a boxed warning — a claim we have seen repeated widely and which we checked against three separate label versions. Hypoglycaemia sits in Warnings and Precautions section 5.1. The section 5.1 numbers matter regardless:

"Hypoglycemia was reported by 30 subjects (42%) at least once during their course of therapy... Five subjects had severe hypoglycemia (requiring assistance and treatment) on one or more occasions and 4 subjects experienced hypoglycemic seizures/loss of consciousness."

Also on the label: tonsillar hypertrophy in 15% of subjects during the first one to two years, intracranial hypertension, slipped capital femoral epiphysis, scoliosis progression, anaphylaxis — and malignant neoplasia as a contraindication.

That is IGF-1 with normal binding-protein interaction, in a monitored paediatric population, at doses set by an approval. DES is designed to increase the free fraction, has never been studied in a human, and is self-administered.

Which IGF-1 DES claims survive the evidence?

Two of ten. IGF-1 DES really is native IGF-1 minus its first three residues — verifiable from UniProt P05019 — and it really is prohibited in sport under WADA S2.3. Everything else fails: reduced IGFBP affinity is unsourced, enhanced local potency is unsourced, human testing has never happened, no safe dose or pharmacokinetic profile exists, it is approved nowhere, the shorter-acting framing is untested, and purity testing cannot detect misfolding.

Claim

Evidence

Verdict

DES is IGF-1 minus the first three residues

Verifiable from UniProt P05019

True

Reduced IGFBP affinity

No primary source found — plausible but unsourced

Unverified

Enhanced local potency

No human or comparative study located

Unverified

Tested in humans

ClinicalTrials.gov: zero studies

Never

Has a known safe dose

No dose-ranging study exists

Unknown

Has known pharmacokinetics

None published

Unknown

Approved anywhere

No marketing authorisation found

No

Shorter-acting than LR3

No comparative human study exists

Unverified

Purity testing confirms it works

Cannot detect misfolding

False

Banned in sport

WADA S2.3, "and its analogues"; named in detection methods

True

The two surviving claims are both structural or legal. Neither of them says the compound does anything.

Where does IGF-1 DES stand with FDA and WADA?

IGF-1 DES appears on neither of FDA's compounding tables. We enumerated both on the page current 22 April 2026 — 14 substances in active Category 2, 17 in the nominated-but-withdrawn table — and no IGF-1 analogue is on either. That absence is not clearance: DES is not a component of any FDA-approved drug, has no USP monograph, and is not on the 503A bulks list, making it an unapproved new drug. WADA S2.3 prohibits it at all times.

We enumerated both tables on the page current 22 April 2026 in full, because absence from a list only means something if you have read the list. Mecasermin is native IGF-1, a different molecule, so DES cannot claim the component-of-an-approved-drug route either. It satisfies none of the three statutory routes.

WADA is explicit. Section S2.3 prohibits "Insulin-like growth factor 1 (IGF-1, mecasermin) and its analogues" at all times, alongside mechano growth factors, FGFs, HGF, PDGF, thymosin-β4 and VEGF.

More concretely for anyone tested: a 2022 method paper on probing for peptidic drugs of 2–10 kDa in doping-control blood samples names "Des 1–3-IGF-I" specifically, alongside long-R3-IGF-I and R3-IGF-I. This compound is not merely covered by a category — testing laboratories have published methods for finding it. See do peptides show up on drug tests.

What do three lab tests and one shop actually tell you?

Very little, and that is the point. The Purity Index records IGF-1 DES at 98.88% average across 3 tests from 2 laboratories — Vanguard and Analiza Białek — against 217 verified shops (verified August 2026). Individual results run 98.00% to 99.65%, and all three samples came in overweight, from +3% to +7.4%. Three tests is not a dataset; it is three data points, and no inference about typical vendor quality can be drawn from it in either direction.

It is by a wide margin the thinnest coverage on this platform. Compare 736 tests for GHK-Cu, 494 for MOTS-c, and 125 for IGF-1 LR3, all against the same platform total of 11,852 independent lab tests across 118 peptides and 530 shops (verified August 2026).

IGF-1 DES price data shows 1 shop in stock at $45.00/mg on a 1 mg vial (verified August 2026). Those figures exclude shipping, taxes and customs, coupon codes, bulk tiers, multi-vial kits and account-gated pricing.

A median computed from a single listing is not a median, and we are flagging that on our own price page. One shop in stock against 217 known vendors describes a compound with essentially no active market.

Check

What it confirms

Reality

Mass spectrometry

Identity against a reference mass

No authoritative reference mass located

Disulfide folding

Three bridges correctly paired

Not testable by MS — misfolded protein has identical mass

HPLC purity

Homogeneity only

Available, but 3 tests total

Fill accuracy

Vial matches label

All three samples overweight, +3% to +7.4%

Endotoxin (LAL)

No pyrogens on an injectable

Not reported

Compare vendors on the IGF-1 DES compound page, and see the full body of independent lab tests for what adequate coverage looks like on other compounds.

The trial that would settle this

The trial that would settle IGF-1 DES has to begin with a published mass and folding specification, because there is no authoritative reference standard to test a batch against. After that: a Phase 1 with human pharmacokinetics and glucose monitoring, IGFBP binding measured in humans rather than asserted, a head-to-head comparison against IGF-1 LR3 to test the shorter-acting framing, and glucose, IGFBP-3 and growth-plate assessment on the safety side.

Element

Requirement

Why

Characterisation

Published mass and folding specification

There is no authoritative reference standard

Phase 1

Human pharmacokinetics with glucose monitoring

Zero human data; hypoglycaemia is the class effect

IGFBP binding

Measured, in humans

The core claim is unsourced

Comparator

LR3, head to head

The "shorter-acting" framing has never been tested

Safety

Glucose, IGFBP-3, and growth-plate assessment

The approved product's warnings define the risk set

Product control

Disulfide pairing confirmed

Misfolded protein passes every routine test

Nothing in that table is unusual for a biologic entering development. All of it is missing here.

Frequently Asked Questions

What is IGF-1 DES?

DES(1-3)IGF-1 — native human IGF-1 with the first three residues, Gly-Pro-Glu, removed, leaving 67 residues. It is one of two IGF-1 analogues sold in this market, the other being IGF-1 LR3.

Why don't you list its molecular weight?

Because we could not verify one against any authoritative registry or regulatory source. The figure can be computed from the sequence, but a computed number presented as a specification is not verification, and without an authoritative reference a mass spectrometry result cannot confirm identity.

Has it been tested in humans?

No. ClinicalTrials.gov returns zero registered studies of IGF-1 DES. There is no published human pharmacokinetic data, no dose-ranging study and no safety data specific to this molecule.

Is it shorter-acting than LR3?

That is the standard marketing framing and no comparative human study supports it. Neither compound has a published human pharmacokinetic profile.

What does the purity data tell me?

Very little. There are three tests from two laboratories in total. That is not enough to characterise vendor quality in either direction, and purity testing cannot detect incorrect disulfide folding, which would render the protein inactive at an identical mass.

Is it banned in sport?

Yes. WADA section S2.3 prohibits IGF-1 "and its analogues" at all times, and DES(1-3)IGF-1 is named specifically in published doping-control detection methods for blood samples.

Where IGF-1 DES sits

IGF-1 DES is the emptiest file on this platform on every axis at once: zero registered human studies, no published pharmacokinetics, no sourced molecular weight, no primary source for the binding-protein claim that is its entire rationale, three lab tests in existence and one shop with stock. The molecule itself is real and the deletion is verifiable from UniProt P05019. Almost everything claimed downstream of that structure is unsourced.

The design logic is coherent, and it deserves that much credit. Deleting the N-terminal tripeptide is a defined, reproducible modification, and the region it removes is implicated in binding-protein interaction.

But it sits in a category where the approved parent drug produces hypoglycaemia in 42% of supervised paediatric patients and carries malignant neoplasia as a contraindication, and it is explicitly named in the anti-doping detection literature. The honest summary is that almost nothing is known about this compound, and what is known about its class is not encouraging.

Browse the growth hormone peptides category, or our complete peptide guide with 118 compounds (verified August 2026). Compare shops through independent lab tests and community-verified shop reviews.

This article is for educational and informational purposes only and does not constitute medical advice. Peptides discussed may be investigational compounds not approved by the FDA (or equivalent regulators in your jurisdiction) for human use. Always consult a qualified healthcare provider before using any peptide or research compound. Peptigrity is an independent review platform and does not sell, endorse, or recommend specific products or vendors.

P
◆ WRITTEN BY

The Peptigrity editorial team covering peptide quality, COA verification, and vendor analysis.

All articles →